Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57190 44 / 2e-06 PSD2 phosphatidylserine decarboxylase 2 (.1) AT4G25970 44 / 2e-06 PSD3, PSD2 phosphatidylserine decarboxylase 3 (.1) AT5G42380 40 / 3e-05 CML39, CML37 CALMODULIN LIKE 39, calmodulin like 37 (.1) AT1G76640 39 / 0.0001 Calcium-binding EF-hand family protein (.1) AT5G19360 38 / 0.0004 CPK34 calcium-dependent protein kinase 34 (.1) AT5G12180 37 / 0.0005 CPK17 calcium-dependent protein kinase 17 (.1) AT2G43290 37 / 0.0006 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) AT1G61950 37 / 0.0006 CPK19 calcium-dependent protein kinase 19 (.1) AT3G59440 37 / 0.0009 Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G030500 [exp] 143 / 2e-46 ND / Potri.014G030800 [exp] 112 / 7e-34 AT3G03430 40 / 9e-06 Calcium-binding EF-hand family protein (.1) Potri.014G030900 [exp] 108 / 3e-32 AT1G66400 41 / 2e-05 calmodulin like 23 (.1) Potri.014G030700 [exp] 94 / 2e-26 ND / Potri.007G042700 [exp] 75 / 6e-19 AT3G20410 42 / 2e-05 calmodulin-domain protein kinase 9 (.1) Potri.008G079066 [exp] 52 / 3e-10 AT2G43290 48 / 8e-08 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.008G079132 [exp] 51 / 7e-10 AT1G05990 45 / 5e-07 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) Potri.002G126900 [exp] 48 / 2e-08 AT4G26470 40 / 4e-05 Calcium-binding EF-hand family protein (.1.2) Potri.014G070700 [exp] 44 / 2e-06 AT1G18210 94 / 2e-24 Calcium-binding EF-hand family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021732 [exp] 114 / 2e-34 AT1G66400 49 / 3e-08 calmodulin like 23 (.1) Lus10036667 [exp] 40 / 7e-05 AT1G18890 804 / 0.0 calcium-dependent protein kinase 1 (.1) Lus10008631 [exp] 39 / 0.0002 AT1G74740 886 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1) Lus10042185 [exp] 39 / 0.0002 AT1G74740 777 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1) Lus10025570 [exp] 37 / 0.0007 AT2G31500 768 / 0.0 calcium-dependent protein kinase 24 (.1) Lus10038460 [exp] 37 / 0.0008 AT5G12180 916 / 0.0 calcium-dependent protein kinase 17 (.1) Lus10002075 [exp] 37 / 0.001 AT4G04720 536 / 0.0 calcium-dependent protein kinase 21 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13202 [poplar] [flax] EF-hand_5 EF hand
Representative CDS sequence Show only first row Show all	>Potri.002G127000.1 pacid=42777751 polypeptide=Potri.002G127000.1.p locus=Potri.002G127000 ID=Potri.002G127000.1.v4.1 annot-version=v4.1 ATGGCAATCAAGTATCGTGGTGTTAATATCGATGGCAAACGTGAAATGACCATGGCGCAGTTCAGGATTTGGGTCAAAACACTTGATGCTGATAAAGATG GCAAGATAAGCAAGGATGAACTCTCTGACGCTGTCCGAGGTAATGGAGGATGGTTTGCTGGTTGGAAGGCAAAGAGGGGGGTAAAGGCAGCAGACGCCAA TGGCAACGGTGTTATTGATGACAGTGAAATCGATATCCTGGCTGCTTTTGCTCAAAAGCACTTGGGTATCATAATTATATAA
AA sequence Show only first row Show all	>Potri.002G127000.1 pacid=42777751 polypeptide=Potri.002G127000.1.p locus=Potri.002G127000 ID=Potri.002G127000.1.v4.1 annot-version=v4.1 MAIKYRGVNIDGKREMTMAQFRIWVKTLDADKDGKISKDELSDAVRGNGGWFAGWKAKRGVKAADANGNGVIDDSEIDILAAFAQKHLGIIII

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25970		PSD3, PSD2	phosphatidylserine decarboxyla...		Potri.002G127000 [exp]	0	1
					Potri.014G030700 [exp]	1.00	0.9594
AT4G31240			protein kinase C-like zinc fin...		Potri.006G279400 [exp]	1.41	0.9372
AT1G69588		CLE45	CLAVATA3/ESR-RELATED 45 (.1)		Potri.010G169300 [exp]	2.44	0.9093
AT1G24620			EF hand calcium-binding protei...		Potri.002G088500 [exp]	3.46	0.9084
AT5G42810		ATIPK1	inositol-pentakisphosphate 2-k...		Potri.005G230200 [exp]	5.19	0.8723
AT1G70880			Polyketide cyclase/dehydrase a...		Potri.004G020100 [exp]	6.48	0.8818
AT5G06800	GARP		myb-like HTH transcriptional r...		Potri.006G191000 [exp]	7.21	0.8670
AT1G28960		ATNUDX15, ATNUD...	ARABIDOPSIS THALIANA NUDIX HYD...		Potri.016G121500 [exp]	11.83	0.8954
AT1G10155		ATPP2-A10	phloem protein 2-A10 (.1)		Potri.015G120100 [exp]	12.32	0.8602
AT2G37390		NAKR2	SODIUM POTASSIUM ROOT DEFECTIV...		Potri.006G213900 [exp]	13.41	0.8636

Compare expression of checked genes

Potri.002G127000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.