Potri.002G130000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G26500 73 / 2e-17 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G037000 127 / 1e-38 AT2G26500 79 / 1e-19 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
Potri.009G108700 97 / 4e-27 AT2G26500 95 / 2e-26 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
Potri.004G147300 79 / 9e-20 AT2G26500 54 / 3e-10 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011665 38 / 0.0004 AT2G26500 105 / 2e-30 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
PFAM info
Representative CDS sequence
>Potri.002G130000.1 pacid=42779843 polypeptide=Potri.002G130000.1.p locus=Potri.002G130000 ID=Potri.002G130000.1.v4.1 annot-version=v4.1
ATGGCAACAGCAGCAGCTGCCTTTGCTCCTGCAACGATAACCCGTGCAGTCATGAACTTTGGCAGCAAGATTCCCAGGAGAACGAACAAGGTGGTTGACA
TTGTAGGAACGAATCCCTATGGAGGTCTAAAAGCCAGCAACAGTGTCCTTGCTCTGAGCATGCCGGTCTCCACCGAGCAGTGCTTTGCAAAAGTGGTTGG
CTCGTTGAGAGCAGCATCAAATACGCACGGAAGAGTTGGAGGTGCACTCTCCTCTAAATGCAGTGATGTGGGTGAGATATTCAGGATTGCTGCAATCATG
AACGGCCTTGTTTTGGGGTTGCTGTTGGATTTGTACTCCTCCGAACTGAAGCGTGGGTCGAGGGAAATGAGTGAGTGTATTGTTTAA
AA sequence
>Potri.002G130000.1 pacid=42779843 polypeptide=Potri.002G130000.1.p locus=Potri.002G130000 ID=Potri.002G130000.1.v4.1 annot-version=v4.1
MATAAAAFAPATITRAVMNFGSKIPRRTNKVVDIVGTNPYGGLKASNSVLALSMPVSTEQCFAKVVGSLRAASNTHGRVGGALSSKCSDVGEIFRIAAIM
NGLVLGLLLDLYSSELKRGSREMSECIV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G26500 cytochrome b6f complex subunit... Potri.002G130000 0 1
AT4G14890 FdC2 ferredoxin C 2, 2Fe-2S ferredo... Potri.010G087300 10.67 0.9191
AT1G74730 Protein of unknown function (D... Potri.012G070600 13.19 0.9172
AT2G30570 PSBW photosystem II reaction center... Potri.002G044300 14.79 0.9167
AT1G30380 PSAK photosystem I subunit K (.1) Potri.018G027600 19.18 0.9161 Pt-PSAK.1
AT4G18740 Rho termination factor (.1.2.3... Potri.004G059300 22.04 0.8945
AT4G05180 PSII-Q, PSBQ, P... photosystem II subunit Q-2 (.1... Potri.004G031500 23.23 0.9146 PSBQ2.1
AT4G10340 LHCB5 light harvesting complex of ph... Potri.019G063101 27.71 0.9144
AT1G54740 Protein of unknown function (D... Potri.013G027100 27.92 0.8797
AT2G06510 ATRPA70A, ATRPA... ARABIDOPSIS THALIANA RPA70-KDA... Potri.018G065300 32.61 0.9117
AT4G21780 unknown protein Potri.011G136500 35.56 0.9056

Potri.002G130000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.