Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47580 145 / 3e-43 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G15690 139 / 3e-38 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G23330 126 / 2e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G33170 125 / 5e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G09950 124 / 8e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G14050 121 / 8e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G16480 120 / 3e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT4G16835 119 / 4e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G25360 119 / 5e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G08820 117 / 2e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G038900 [exp] 269 / 1e-89 AT2G15690 280 / 1e-88 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G058300 [exp] 154 / 2e-43 AT2G15690 499 / 2e-170 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G116600 [exp] 136 / 3e-37 AT2G25580 452 / 3e-151 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G081700 [exp] 132 / 1e-35 AT4G16835 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G077700 [exp] 130 / 5e-35 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G152300 [exp] 126 / 1e-33 AT4G33990 489 / 1e-162 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G044700 [exp] 126 / 2e-33 AT3G22690 582 / 0.0 unknown protein Potri.015G018700 [exp] 124 / 1e-32 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G136200 [exp] 123 / 2e-32 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014049 [exp] 139 / 3e-38 AT2G15690 478 / 2e-163 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019864 [exp] 138 / 5e-38 AT2G15690 477 / 3e-163 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040577 [exp] 135 / 6e-38 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004892 [exp] 128 / 5e-34 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10032688 [exp] 122 / 2e-32 AT2G15690 375 / 2e-124 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013149 [exp] 122 / 4e-32 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10041867 [exp] 122 / 6e-32 AT2G25580 447 / 2e-149 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028413 [exp] 121 / 1e-31 AT2G25580 447 / 8e-150 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008570 [exp] 119 / 3e-31 AT2G15690 375 / 9e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10000706 [exp] 117 / 3e-30 AT3G12770 878 / 0.0 mitochondrial editing factor 22 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0109 [poplar] [flax] CDA PF14432 [poplar] [flax] DYW_deaminase DYW family of nucleic acid deaminases
Representative CDS sequence Show only first row Show all	>Potri.002G130900.2 pacid=42776947 polypeptide=Potri.002G130900.2.p locus=Potri.002G130900 ID=Potri.002G130900.2.v4.1 annot-version=v4.1 ATGAAAGAAGATGGGATTAGGCCATATGGGTCTAGCTTTGTTGTTGTTTTAATGGCTTGCATGTGCTTAGGGGCAGAGAAGGAAGGACATAAACATTTTG AGTCAATGAGCAGGGGTTATGGGATCATTCTCGCAGAAGAGCATTATGAAGCTATGGTTGATCTTCTTGGAAGATCAGGAAAGATAGCGGAGTGCAAAGG AGTTTGTTGCAAATATACCAATCGACTCAAGCACCAGAGTTTGGGAGACTCTACAGAAGCACTCGAAAGCCAGAACACAAGGGCAACTGGGTTATTCTGT ATCACCATAAGGGCAAAGGACAGCTTTAACATAAATTATAAAAGAGCGACTTCAGACGGGATCAAGGCATATGAAAAGTTGAGGTCTTTGAGTAAAGAGG TAAGGGATGCTGGATATTTGCCGGACACAAGGTTTGTGTTTCATGATCTTGACCAAGAGGCGAAGGAGAAGACCTTGTTCTACCACATTGAAAGGATAGC CATTGCTTATGGGCTTATCAATACTCCTCGTGGGACCTCTTTAAGGATAATGAAAAACCTAAGGATTTGTGGGGACTGTCATAATTTCATCAAGATCCTT TCCAAAATGAAGAACCGATAG
AA sequence Show only first row Show all	>Potri.002G130900.2 pacid=42776947 polypeptide=Potri.002G130900.2.p locus=Potri.002G130900 ID=Potri.002G130900.2.v4.1 annot-version=v4.1 MKEDGIRPYGSSFVVVLMACMCLGAEKEGHKHFESMSRGYGIILAEEHYEAMVDLLGRSGKIAECKGVCCKYTNRLKHQSLGDSTEALESQNTRATGLFC ITIRAKDSFNINYKRATSDGIKAYEKLRSLSKEVRDAGYLPDTRFVFHDLDQEAKEKTLFYHIERIAIAYGLINTPRGTSLRIMKNLRICGDCHNFIKIL SKMKNR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47580			Pentatricopeptide repeat (PPR)...		Potri.002G130900 [exp]	0	1
AT1G16260			Wall-associated kinase family ...		Potri.009G157201 [exp]	3.31	0.9155
AT5G05800			unknown protein		Potri.001G238000 [exp]	5.83	0.9105
AT3G11310			unknown protein		Potri.001G182200 [exp]	6.00	0.9072
AT2G30150			UDP-Glycosyltransferase superf...		Potri.009G077400 [exp]	8.00	0.8338
AT4G39110			Malectin/receptor-like protein...		Potri.009G120400 [exp]	10.95	0.8354
AT1G05790			lipase class 3 family protein ...		Potri.002G231534 [exp]	12.68	0.8775
					Potri.017G065250 [exp]	14.07	0.8495
AT1G05790			lipase class 3 family protein ...		Potri.002G231567 [exp]	14.86	0.8549
AT5G05800			unknown protein		Potri.001G195601 [exp]	15.90	0.8647
AT4G24690		AtNBR1	Arabidopsis thaliana next to B...		Potri.012G085450 [exp]	18.33	0.8440

Compare expression of checked genes

Potri.002G130900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.