Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42655 136 / 4e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G64160 51 / 8e-08 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G23690 47 / 2e-06 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 45 / 8e-06 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13662 45 / 9e-06 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G07730 45 / 2e-05 Disease resistance-responsive (dirigent-like protein) family protein (.2) AT3G13660 42 / 7e-05 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 42 / 8e-05 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT5G42500 42 / 8e-05 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G58090 41 / 0.0002 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G142401 [exp] 50 / 2e-07 AT1G64160 223 / 3e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G096560 [exp] 50 / 2e-07 AT1G64160 223 / 3e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.008G061400 [exp] 50 / 2e-07 AT2G21110 223 / 7e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.010G197000 [exp] 47 / 1e-06 AT2G21110 195 / 7e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216200 [exp] 46 / 5e-06 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.001G023800 [exp] 45 / 6e-06 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 44 / 2e-05 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216400 [exp] 41 / 0.0002 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216300 [exp] 41 / 0.0002 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032310 [exp] 172 / 3e-54 AT5G42655 125 / 2e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10024684 [exp] 169 / 4e-48 AT5G42660 445 / 2e-139 Protein of unknown function (DUF616) (.1) Lus10017539 [exp] 52 / 3e-08 AT1G64160 238 / 9e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10039561 [exp] 51 / 8e-08 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10028749 [exp] 50 / 2e-07 AT1G64160 232 / 2e-78 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025067 [exp] 49 / 6e-07 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 48 / 1e-06 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 47 / 2e-06 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10027834 [exp] 45 / 1e-05 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 44 / 2e-05 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF03018 [poplar] [flax] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Potri.002G131500.1 pacid=42778354 polypeptide=Potri.002G131500.1.p locus=Potri.002G131500 ID=Potri.002G131500.1.v4.1 annot-version=v4.1 ATGCTTCAGACAGGTCCTCTTAAGAGCACATTCAAGGCTAACATATTTCAAAGAGCCAAGAAGGTTGCGTGCATGATGCGGTGTCGGATCATACTCTGCA CTGCAGTTTCTTTAGCATTACTGACAGTCCTTCTCCTGGCTTTGATCTCACCAGTCCCTCATGATAAAAATCAATCAGATAACTCGACAAGGCCTAGGCC TAGGCCTTGGCTGGCCCTGTCATTGTACATCCAGCAACCTCAAATCTCGAGTTCTGACGTTCAGCCAGCGGTAAGATCCGAAGCTGGAGCATTCATCTTT CATCGTAAGCTCACAGAAGGGCTCGAAAACACTTCACGGGTCATAGGAAAAGCTCAAGGCTTCATAATTCCAATAGAACATTTTGCGTATTCAGGTTTCA ATATTATCTACCTCACATTTGATACACCTGATTACTCAGGCAGCCTCAGTGTGCAGGCCAAGCATGTAGAGCATAAAGATAGAGAAGAACTCACGGTGGT TGGTGGAACTGGGTCATTCGCATTTGCTCGAGGTCTCGCTGTTTTTGCACAGACTGATCCACAGCCCACTGACGTCGGTGGAACATACCATGTGAAGCTT CAGCTTCAGCTTAGGTTTCCAGATCGATCTCATACAAATATTCCAGGATGA
AA sequence Show only first row Show all	>Potri.002G131500.1 pacid=42778354 polypeptide=Potri.002G131500.1.p locus=Potri.002G131500 ID=Potri.002G131500.1.v4.1 annot-version=v4.1 MLQTGPLKSTFKANIFQRAKKVACMMRCRIILCTAVSLALLTVLLLALISPVPHDKNQSDNSTRPRPRPWLALSLYIQQPQISSSDVQPAVRSEAGAFIF HRKLTEGLENTSRVIGKAQGFIIPIEHFAYSGFNIIYLTFDTPDYSGSLSVQAKHVEHKDREELTVVGGTGSFAFARGLAVFAQTDPQPTDVGGTYHVKL QLQLRFPDRSHTNIPG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G42655			Disease resistance-responsive ...		Potri.002G131500 [exp]	0	1
AT1G56050			GTP-binding protein-related (....		Potri.011G143700 [exp]	3.46	0.8057
AT3G48970			Heavy metal transport/detoxifi...		Potri.015G144300 [exp]	3.74	0.8266
AT2G17950	HD	WUS1, PGA6, WUS	WUSCHEL 1, WUSCHEL, Homeodomai...		Potri.005G114700 [exp]	3.74	0.7755	WUS.1
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Potri.010G197200 [exp]	5.00	0.8486
AT3G22990		LFR	LEAF AND FLOWER RELATED, ARM r...		Potri.008G159900 [exp]	7.54	0.7261
AT3G07190			B-cell receptor-associated pro...		Potri.002G245300 [exp]	15.19	0.7828
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Potri.009G132000 [exp]	15.49	0.7616
AT5G19350			RNA-binding (RRM/RBD/RNP motif...		Potri.009G054400 [exp]	17.94	0.7567
AT5G52220			unknown protein		Potri.015G140200 [exp]	23.87	0.7635
AT5G06620		SDG38, ATXR4	SET domain protein 38 (.1)		Potri.006G196566 [exp]	26.55	0.8044

Compare expression of checked genes

Potri.002G131500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.