Pt-RPS9.2 (Potri.002G132200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-RPS9.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G74970 268 / 8e-92 TWN3, RPS9 ribosomal protein S9 (.1)
AT3G49080 95 / 1e-22 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G039600 290 / 1e-100 AT1G74970 268 / 4e-92 ribosomal protein S9 (.1)
Potri.012G144700 92 / 8e-22 AT3G49080 353 / 5e-119 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032862 266 / 2e-91 AT1G74970 282 / 1e-97 ribosomal protein S9 (.1)
Lus10016295 266 / 2e-91 AT1G74970 276 / 3e-95 ribosomal protein S9 (.1)
Lus10038852 96 / 4e-23 AT3G49080 370 / 9e-126 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10014970 0 / 1 AT3G49080 274 / 8e-95 Ribosomal protein S5 domain 2-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0329 S5 PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Representative CDS sequence
>Potri.002G132200.1 pacid=42778392 polypeptide=Potri.002G132200.1.p locus=Potri.002G132200 ID=Potri.002G132200.1.v4.1 annot-version=v4.1
ATGTCAATCTCAATCTCCTCTCTTGCATCATCCCTCTCTTCACTCTCATTTTCCTCTCAAATTTCCCAAAAACCAAACACCCTTTCATTTTCTCGGTCCA
AATCTCTCTCTCTCTCACTCTCCCCCTACTCCAACTCCAACAAACAGCCCTTTACTCTCCGTGTCACCGCCACCGTTGCCTCTCCCGAAACAACCACCAC
GGACCTCAAGAAATTAGTGAAATCGAGACTCCCTGGTGGTTTCGCAGCTCAACCTATTCATGGCACTGGTCGCCGAAAATGCGCCATTGCTCGTGTTGTT
CTTCAAGAAGGCACTGGCAAAGTTATAATCAATTATCGCGACGCAAAGGAATATCTCCAAGGAAATCCATTGTGGCTTCAGTATGTGAAAGTTCCACTGG
TAACTCTGGGGTACGAGAGCAGCTACGATGTGTTTGTCAAGGCTCATGGAGGTGGCCTCTCTGGTCAGGCTCAGGCAATCTCCCTTGGCGTTGCTCGTGC
ATTGCTAAAGGTGAGTCAGAACCACAGAATACCTTTGAAAAGGGAAGGGCTTCTAACCAGAGACTCGAGAATAGTTGAGAGGAAGAAGGTTGGTCTCAAG
AAAGCTCGCAAGGCCCCACAATTTTCCAAACGTTGA
AA sequence
>Potri.002G132200.1 pacid=42778392 polypeptide=Potri.002G132200.1.p locus=Potri.002G132200 ID=Potri.002G132200.1.v4.1 annot-version=v4.1
MSISISSLASSLSSLSFSSQISQKPNTLSFSRSKSLSLSLSPYSNSNKQPFTLRVTATVASPETTTTDLKKLVKSRLPGGFAAQPIHGTGRRKCAIARVV
LQEGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYESSYDVFVKAHGGGLSGQAQAISLGVARALLKVSQNHRIPLKREGLLTRDSRIVERKKVGLK
KARKAPQFSKR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G74970 TWN3, RPS9 ribosomal protein S9 (.1) Potri.002G132200 0 1 Pt-RPS9.2
AT1G74970 TWN3, RPS9 ribosomal protein S9 (.1) Potri.014G039600 1.00 0.9912 RPS9.1
AT4G22830 unknown protein Potri.001G114800 1.41 0.9883
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Potri.010G127300 2.44 0.9882
AT5G57345 unknown protein Potri.006G165800 3.46 0.9849
AT1G11430 plastid developmental protein ... Potri.011G032900 4.58 0.9839
AT2G35490 Plastid-lipid associated prote... Potri.001G137900 5.65 0.9839
AT3G20680 Domain of unknown function (DU... Potri.011G132500 6.00 0.9814
AT3G13120 Ribosomal protein S10p/S20e fa... Potri.011G092800 6.32 0.9854
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Potri.004G140500 6.70 0.9852
AT3G08740 elongation factor P (EF-P) fam... Potri.016G136600 8.12 0.9816

Potri.002G132200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.