Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42380 99 / 1e-26 CML39, CML37 CALMODULIN LIKE 39, calmodulin like 37 (.1) AT1G76650 96 / 9e-26 CML38 calmodulin-like 38 (.1.2.3) AT1G76640 87 / 1e-22 Calcium-binding EF-hand family protein (.1) AT3G01830 83 / 4e-21 Calcium-binding EF-hand family protein (.1.2) AT1G24620 80 / 2e-19 EF hand calcium-binding protein family (.1) AT3G50770 75 / 2e-17 CML41 calmodulin-like 41 (.1) AT1G66400 73 / 5e-17 CML23 calmodulin like 23 (.1) AT5G37770 69 / 1e-15 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT5G17470 69 / 1e-15 EF hand calcium-binding protein family (.1) AT1G18210 68 / 6e-15 Calcium-binding EF-hand family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G093800 [exp] 209 / 1e-70 AT1G76650 101 / 8e-28 calmodulin-like 38 (.1.2.3) Potri.001G332900 [exp] 117 / 2e-34 AT1G76650 115 / 2e-33 calmodulin-like 38 (.1.2.3) Potri.005G259900 [exp] 113 / 3e-32 AT1G76650 156 / 2e-48 calmodulin-like 38 (.1.2.3) Potri.002G001400 [exp] 110 / 3e-31 AT5G42380 160 / 6e-50 CALMODULIN LIKE 39, calmodulin like 37 (.1) Potri.007G031900 [exp] 87 / 3e-22 AT3G50770 147 / 1e-44 calmodulin-like 41 (.1) Potri.005G128100 [exp] 80 / 2e-19 AT3G50770 188 / 7e-61 calmodulin-like 41 (.1) Potri.015G039500 [exp] 75 / 1e-17 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2) Potri.010G107100 [exp] 75 / 2e-17 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1) Potri.008G134300 [exp] 75 / 3e-17 AT1G24620 219 / 2e-73 EF hand calcium-binding protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018845 [exp] 124 / 1e-33 AT3G12340 114 / 3e-29 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10022343 [exp] 109 / 2e-31 AT1G76650 132 / 7e-40 calmodulin-like 38 (.1.2.3) Lus10032734 [exp] 86 / 3e-21 AT3G50770 153 / 5e-47 calmodulin-like 41 (.1) Lus10004330 [exp] 76 / 4e-18 AT1G24620 207 / 2e-69 EF hand calcium-binding protein family (.1) Lus10028913 [exp] 75 / 1e-17 AT1G24620 204 / 5e-68 EF hand calcium-binding protein family (.1) Lus10024574 [exp] 66 / 2e-14 AT1G24620 143 / 4e-44 EF hand calcium-binding protein family (.1) Lus10009059 [exp] 66 / 4e-14 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10018012 [exp] 66 / 6e-14 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10000972 [exp] 66 / 6e-14 AT1G21550 128 / 3e-38 Calcium-binding EF-hand family protein (.1) Lus10001775 [exp] 65 / 9e-14 AT2G27030 192 / 1e-63 calmodulin 5 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.002G132500.1 pacid=42779741 polypeptide=Potri.002G132500.1.p locus=Potri.002G132500 ID=Potri.002G132500.1.v4.1 annot-version=v4.1 ATGGTTAACGCTGGAGAATTTGAAGTTGTTTTTCGCTGCCTTGATGAAGATGGTGATGGGAAGGTCTCACCATCTGAGTTAAGTCATCGTCTAAGTTTGA TTGGAGGAGATTTGCTCATGAAGGAGGCAGAACTTGCTGTGGAGTCGTTGGACTCAGACGGAGATGGCTTGTTGGGATTGGAGGATCTTGTTAGGCTAAT GGAAGCTGGAGGAGAAGAAGAGAAGTTGCATGATTTGAGAGAGGCTTTTCACTTGTATGATATAGATAATTGTGGGTTTATCAGAGCCAAGGACTTGAAA ACAATGCTTGGTAGACTTGGAGAGTCAAGATCAATTGATGAATGCGAAGTGATGATAAACAAGTTTGACCTTAATGGGGATGGTGTTCTTAGCTTTGAAG AATTTATGGTTATGATGAAATGA
AA sequence Show only first row Show all	>Potri.002G132500.1 pacid=42779741 polypeptide=Potri.002G132500.1.p locus=Potri.002G132500 ID=Potri.002G132500.1.v4.1 annot-version=v4.1 MVNAGEFEVVFRCLDEDGDGKVSPSELSHRLSLIGGDLLMKEAELAVESLDSDGDGLLGLEDLVRLMEAGGEEEKLHDLREAFHLYDIDNCGFIRAKDLK TMLGRLGESRSIDECEVMINKFDLNGDGVLSFEEFMVMMK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G42380		CML39, CML37	CALMODULIN LIKE 39, calmodulin...		Potri.002G132500 [exp]	0	1
					Potri.018G119400 [exp]	2.44	0.9760
					Potri.002G122400 [exp]	2.82	0.9719
AT1G14540			Peroxidase superfamily protein...		Potri.008G022700 [exp]	3.87	0.9725
AT1G14540			Peroxidase superfamily protein...		Potri.008G022248 [exp]	5.47	0.9639
AT4G17490	AP2_ERF	ERF-6-6, ATERF6	ethylene responsive element bi...		Potri.003G080600 [exp]	5.83	0.9448
					Potri.018G122600 [exp]	6.00	0.9590
AT5G10530			Concanavalin A-like lectin pro...		Potri.001G283866 [exp]	6.24	0.9487
AT5G10530			Concanavalin A-like lectin pro...		Potri.001G283208 [exp]	7.54	0.9423
AT1G14550			Peroxidase superfamily protein...		Potri.008G022232 [exp]	8.36	0.9632
AT1G18350		ATMKK7, BUD1	MAP KINASE KINASE7, BUSHY AND ...		Potri.008G183700 [exp]	9.48	0.9434

Compare expression of checked genes

Potri.002G132500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.