Potri.002G133200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75030 136 / 2e-40 ATLP-3 thaumatin-like protein 3 (.1)
AT1G75050 129 / 7e-38 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75040 122 / 5e-35 PR-5, PR5 pathogenesis-related gene 5 (.1)
AT1G77700 109 / 3e-29 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G18250 107 / 3e-29 ATLP-1 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G19320 103 / 1e-27 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G73620 103 / 2e-27 Pathogenesis-related thaumatin superfamily protein (.1)
AT4G38660 92 / 9e-23 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT5G24620 92 / 3e-22 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT5G40020 89 / 5e-22 Pathogenesis-related thaumatin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G040700 176 / 4e-56 AT1G75030 342 / 5e-120 thaumatin-like protein 3 (.1)
Potri.015G039200 107 / 3e-29 AT1G73620 352 / 1e-123 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G173900 107 / 6e-29 AT1G77700 316 / 2e-107 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.012G047800 105 / 3e-28 AT1G73620 379 / 3e-134 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G112600 103 / 3e-27 AT4G38660 348 / 2e-119 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.002G087100 102 / 4e-27 AT1G77700 384 / 2e-134 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G210400 99 / 1e-25 AT1G77700 273 / 1e-90 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.009G132500 99 / 2e-25 AT4G38660 338 / 3e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.004G173200 97 / 2e-24 AT4G38660 357 / 5e-123 Pathogenesis-related thaumatin superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032726 153 / 5e-47 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1)
Lus10009058 111 / 1e-30 AT1G73620 376 / 2e-133 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10041899 99 / 3e-25 AT4G38660 363 / 2e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10028447 95 / 9e-24 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10028448 93 / 3e-23 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041901 92 / 4e-23 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10025055 89 / 5e-22 AT4G38660 359 / 6e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10025629 89 / 2e-21 AT1G77700 377 / 4e-130 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10032914 86 / 6e-21 AT5G24620 353 / 1e-121 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10015591 86 / 1e-20 AT5G24620 353 / 1e-120 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Potri.002G133200.2 pacid=42777367 polypeptide=Potri.002G133200.2.p locus=Potri.002G133200 ID=Potri.002G133200.2.v4.1 annot-version=v4.1
ATGGCAATTTCCTCAATCTTTTTAACTGGATGCGCGTTTGATGAACCAGGCAATGGCAAGTGCATAACCGGTGACTGTGGTGGCACTCTAAAGTGTATTG
GTGGTGGTTCTCCTCCTGTTGGTCCTGTGGAAGACTTTTATGATGTGAGTCTTGTTGATGGATACAATGGTGGCTTAGGTGTTAAGGCATTGGGTGGGTC
TGGTGATTGTCAATATGCGGGTTGTGTTGCGGATCTTAAGGGGAACTGCCCCACGGAGCTCCGGGTCATGGATTCGGGTTCTACTGTTGCTTGCAAGAGT
GCTTGTTCCGCCTTAAACGCCCCCGAACTTTCTTCCCGACACAATACTCAGATGTTCAAGAATGCGTGCCCGACAGCATATAGTTATGCTTATGATGATG
CCTCAAGTGCTTGTACTTGCACCGGGTCTGATTACTTGATCATATTTTGTCCAAATGGGTCTGGATGA
AA sequence
>Potri.002G133200.2 pacid=42777367 polypeptide=Potri.002G133200.2.p locus=Potri.002G133200 ID=Potri.002G133200.2.v4.1 annot-version=v4.1
MAISSIFLTGCAFDEPGNGKCITGDCGGTLKCIGGGSPPVGPVEDFYDVSLVDGYNGGLGVKALGGSGDCQYAGCVADLKGNCPTELRVMDSGSTVACKS
ACSALNAPELSSRHNTQMFKNACPTAYSYAYDDASSACTCTGSDYLIIFCPNGSG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G75030 ATLP-3 thaumatin-like protein 3 (.1) Potri.002G133200 0 1
AT1G71692 MADS XAL1, AGL12 XAANTAL1, AGAMOUS-like 12 (.1) Potri.019G076800 1.41 0.9242 AGL12.1
AT2G45640 ATSAP18, HDA19 SIN3 ASSOCIATED POLYPEPTIDE 18... Potri.014G074000 10.00 0.8204
AT5G20810 SAUR-like auxin-responsive pro... Potri.018G063400 12.36 0.8246
AT5G04080 unknown protein Potri.006G043300 13.85 0.8585
AT5G43240 Protein of unknown function (D... Potri.001G247300 15.62 0.8592
AT5G62350 Plant invertase/pectin methyle... Potri.012G127500 18.84 0.8589
AT1G32583 unknown protein Potri.015G101000 21.49 0.7967
AT1G29380 Carbohydrate-binding X8 domain... Potri.011G078500 21.49 0.8637
AT5G56760 SAT-52, AtSerat... SERINE ACETYLTRANSFERASE 52, s... Potri.015G147000 25.61 0.7969
AT3G27030 unknown protein Potri.017G064500 28.49 0.8557

Potri.002G133200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.