Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36800 56 / 3e-11 RCE1 RUB1 conjugating enzyme 1 (.1.2) AT2G18600 56 / 4e-11 Ubiquitin-conjugating enzyme family protein (.1) AT3G08700 39 / 5e-05 UBC12 ubiquitin-conjugating enzyme 12 (.1) AT2G16740 39 / 6e-05 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G41700 39 / 7e-05 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT5G53300 39 / 7e-05 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT4G27960 39 / 8e-05 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT1G64230 38 / 0.0001 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G56150 38 / 0.0001 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT3G08690 38 / 0.0001 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G041532 [exp] 56 / 7e-12 AT4G36800 137 / 5e-42 RUB1 conjugating enzyme 1 (.1.2) Potri.T125904 [exp] 56 / 2e-11 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2) Potri.009G113045 [exp] 56 / 2e-11 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2) Potri.007G030900 [exp] 56 / 4e-11 AT4G36800 340 / 2e-121 RUB1 conjugating enzyme 1 (.1.2) Potri.005G126500 [exp] 56 / 4e-11 AT4G36800 332 / 3e-118 RUB1 conjugating enzyme 1 (.1.2) Potri.004G175000 [exp] 40 / 2e-05 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.011G168200 [exp] 39 / 8e-05 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.001G471200 [exp] 39 / 8e-05 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 39 / 8e-05 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014329 [exp] 58 / 1e-11 AT4G36800 332 / 3e-117 RUB1 conjugating enzyme 1 (.1.2) Lus10026038 [exp] 56 / 4e-11 AT4G36800 341 / 1e-121 RUB1 conjugating enzyme 1 (.1.2) Lus10010143 [exp] 50 / 4e-09 AT4G36800 257 / 1e-88 RUB1 conjugating enzyme 1 (.1.2) Lus10005072 [exp] 41 / 2e-05 AT4G27960 291 / 3e-98 ubiquitin conjugating enzyme 9 (.1.2) Lus10010433 [exp] 40 / 3e-05 AT5G05080 253 / 6e-85 ubiquitin-conjugating enzyme 22 (.1.2) Lus10027846 [exp] 40 / 3e-05 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 38 / 0.0001 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10021385 [exp] 38 / 0.0001 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 38 / 0.0001 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 38 / 0.0001 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.002G133632.1 pacid=42777119 polypeptide=Potri.002G133632.1.p locus=Potri.002G133632 ID=Potri.002G133632.1.v4.1 annot-version=v4.1 ATGACAAGGGTACATATGCAATGTTTCGTTCTACAGTCAATCTCTCTCCTGTTATGCTATCTGCAGGTCTGCCATCCTAATATTGATCTGGAAGGCAATG TGTGCCTTAACATTCTTGGAGAAGACTGGAAACCTATCCTTCTTTTATATATGATTTTAACTCCGCATTTATCCTCCCTTTTCATTCCTTCTTCACTTTC ATTGTTCCATGTCAGGTCTTAA
AA sequence Show only first row Show all	>Potri.002G133632.1 pacid=42777119 polypeptide=Potri.002G133632.1.p locus=Potri.002G133632 ID=Potri.002G133632.1.v4.1 annot-version=v4.1 MTRVHMQCFVLQSISLLLCYLQVCHPNIDLEGNVCLNILGEDWKPILLLYMILTPHLSSLFIPSSLSLFHVRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Potri.002G133632 [exp]	0	1
AT3G12360		ITN1	INCREASED TOLERANCE TO NACL, A...		Potri.008G048400 [exp]	8.94	0.7606
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014360 [exp]	10.95	0.7212
AT5G47610			RING/U-box superfamily protein...		Potri.001G453800 [exp]	16.97	0.7372
					Potri.008G007100 [exp]	18.24	0.7799
AT1G16900			Alg9-like mannosyltransferase ...		Potri.001G392050 [exp]	18.70	0.7390
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Potri.014G025700 [exp]	21.07	0.7614	NAC146
AT1G30220		ATINT2	ARABIDOPSIS THALIANA INOSITOL ...		Potri.004G133340 [exp]	25.45	0.7527
AT5G27650			Tudor/PWWP/MBT superfamily pro...		Potri.008G209900 [exp]	26.72	0.7105
AT2G45040			Matrixin family protein (.1)		Potri.003G077400 [exp]	27.49	0.7346
					Potri.006G219750 [exp]	30.33	0.7526

Compare expression of checked genes

Potri.002G133632 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.