Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44620 177 / 9e-59 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1) AT1G65290 110 / 3e-32 MTACP2 mitochondrial acyl carrier protein 2 (.1) AT5G47630 74 / 1e-17 MTACP3 mitochondrial acyl carrier protein 3 (.1.2) AT3G05020 51 / 5e-09 ACP1 acyl carrier protein 1 (.1) AT5G27200 47 / 2e-07 ACP5 acyl carrier protein 5 (.1) AT1G54630 44 / 2e-06 ACP3 acyl carrier protein 3 (.1.2) AT1G54580 44 / 2e-06 ACP2 acyl carrier protein 2 (.1) AT4G25050 43 / 4e-06 ACP4 acyl carrier protein 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G044000 [exp] 213 / 4e-73 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1) Potri.019G055300 [exp] 119 / 7e-36 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1) Potri.013G084500 [exp] 107 / 3e-31 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1) Potri.016G006300 [exp] 72 / 3e-17 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2) Potri.006G005700 [exp] 72 / 4e-17 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2) Potri.006G217800 [exp] 51 / 5e-09 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2) Potri.005G044800 [exp] 42 / 1e-05 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1) Potri.012G105300 [exp] 41 / 2e-05 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2) Potri.013G031300 [exp] 40 / 4e-05 AT3G05020 142 / 1e-44 acyl carrier protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019500 [exp] 176 / 2e-58 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10043348 [exp] 176 / 2e-58 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10020221 [exp] 105 / 4e-30 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1) Lus10026849 [exp] 107 / 6e-28 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3) Lus10038782 [exp] 68 / 1e-15 AT5G47630 112 / 6e-33 mitochondrial acyl carrier protein 3 (.1.2) Lus10000050 [exp] 67 / 4e-15 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10039077 [exp] 67 / 4e-15 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10033836 [exp] 43 / 5e-06 AT4G25050 137 / 2e-42 acyl carrier protein 4 (.1.2) Lus10037908 [exp] 43 / 6e-06 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2) Lus10038636 [exp] 43 / 6e-06 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0314 [poplar] [flax] PP-binding PF00550 [poplar] [flax] PP-binding Phosphopantetheine attachment site
Representative CDS sequence Show only first row Show all	>Potri.002G135600.2 pacid=42779641 polypeptide=Potri.002G135600.2.p locus=Potri.002G135600 ID=Potri.002G135600.2.v4.1 annot-version=v4.1 ATGGCATTGAGAGCAGCCGTGCTACGTCACATTCGGGTGCCGGTGCAAACCCTAAGACTCAAAACAAATCCATGTGCTCCGTCTGGTTCAGTCCGGTTAA TGTCGTCGCATGATGACCATCTGACCAAGGAAGAGGTCGTCGACAGAGTTGTCTCTGTTGTCAAGAGCTTCCCTAAAGTCGATCCTTCCAGGGTGTCTCC TGAAGTCCATTTCCAGAAAGATCTGGGCTTGGATAGCTTGGACAATGTGGAGATTGTAATGGCTCTAGAAGAGGAGTTCAAGCTTGAAATTCCAGACAAG GAAGCCGATAAGATTGACTCTTGTAACCTTGCTATTGAGTACATTCATAACCATCCGCTGGCTAGTTGA
AA sequence Show only first row Show all	>Potri.002G135600.2 pacid=42779641 polypeptide=Potri.002G135600.2.p locus=Potri.002G135600 ID=Potri.002G135600.2.v4.1 annot-version=v4.1 MALRAAVLRHIRVPVQTLRLKTNPCAPSGSVRLMSSHDDHLTKEEVVDRVVSVVKSFPKVDPSRVSPEVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDK EADKIDSCNLAIEYIHNHPLAS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Potri.002G135600 [exp]	0	1
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.008G044400 [exp]	1.00	0.9505	Pt-RPS23.3
AT1G26880			Ribosomal protein L34e superfa...		Potri.001G195101 [exp]	3.46	0.9307
AT1G16000			unknown protein		Potri.003G183501 [exp]	10.95	0.8952
AT5G62300			Ribosomal protein S10p/S20e fa...		Potri.015G129800 [exp]	14.28	0.9099	RPS20.2
AT4G21895			DNA binding (.1)		Potri.004G017000 [exp]	14.38	0.8957
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.003G136400 [exp]	14.86	0.9097
AT3G56340			Ribosomal protein S26e family ...		Potri.019G057000 [exp]	15.09	0.9238	RPS26.2
AT4G39200			Ribosomal protein S25 family p...		Potri.009G118900 [exp]	15.19	0.9148
AT5G27700			Ribosomal protein S21e (.1)		Potri.005G026000 [exp]	15.62	0.9195
AT2G16600		ROC3	rotamase CYP 3 (.1.2)		Potri.004G168800 [exp]	15.68	0.8819	VCCYP.1

Compare expression of checked genes

Potri.002G135600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.