Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60370 96 / 3e-26 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 35 / 0.001 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G045600 [exp] 108 / 2e-31 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042897 [exp] 100 / 5e-28 AT3G60370 312 / 8e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10028194 [exp] 96 / 9e-26 AT3G60370 305 / 2e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G136800.1 pacid=42778662 polypeptide=Potri.002G136800.1.p locus=Potri.002G136800 ID=Potri.002G136800.1.v4.1 annot-version=v4.1 ATGAGACCTGGGGGGAAGAGAAAGATAATCATTCCTCAAGAACTTGGGCCACCGGTCGGACCTTCTACATTTTTCAGCTCAAAACAGTTCGAAGTTTTTG ATGTGGAACTCCTCAATTTTAAGGACTGTCAAAGGAAGACTACAGGATTTTACTCTGACGTTGTGTGCGACTGA
AA sequence Show only first row Show all	>Potri.002G136800.1 pacid=42778662 polypeptide=Potri.002G136800.1.p locus=Potri.002G136800 ID=Potri.002G136800.1.v4.1 annot-version=v4.1 MRPGGKRKIIIPQELGPPVGPSTFFSSKQFEVFDVELLNFKDCQRKTTGFYSDVVCD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60370			FKBP-like peptidyl-prolyl cis-...		Potri.002G136800 [exp]	0	1
AT5G06540			Pentatricopeptide repeat (PPR)...		Potri.016G065500 [exp]	4.00	0.9270
AT1G08125			S-adenosyl-L-methionine-depend...		Potri.009G006800 [exp]	9.64	0.8540
AT5G08305			Pentatricopeptide repeat (PPR)...		Potri.007G073100 [exp]	15.19	0.8813
AT2G26550		HO2	heme oxygenase 2 (.1.2.3)		Potri.014G034200 [exp]	19.74	0.8865
AT4G14050			Pentatricopeptide repeat (PPR)...		Potri.001G321700 [exp]	19.89	0.8830
AT5G08310			Tetratricopeptide repeat (TPR)...		Potri.005G090600 [exp]	25.69	0.8694
					Potri.019G045466 [exp]	25.69	0.8293
AT5G06400			Pentatricopeptide repeat (PPR)...		Potri.006G200800 [exp]	26.66	0.8730
AT1G79490		EMB2217	embryo defective 2217, Pentatr...		Potri.010G173400 [exp]	27.74	0.8729
AT2G20710			Tetratricopeptide repeat (TPR)...		Potri.016G063400 [exp]	31.52	0.8675

Compare expression of checked genes

Potri.002G136800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.