Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09320 271 / 8e-95 NDPK1 Nucleoside diphosphate kinase family protein (.1) AT5G63310 196 / 3e-64 NDPK1A, NDPKIAIA, NDPK2, ATNDPK2 NDP KINASE 1A, NUCLEOSIDE DIPHOSPHATE KINASE IA, ARABIDOPSIS NUCLEOSIDE DIPHOSPHATE KINASE 2, nucleoside diphosphate kinase 2 (.1) AT4G23900 192 / 7e-63 Nucleoside diphosphate kinase family protein (.1) AT4G11010 192 / 1e-62 NDPK3 nucleoside diphosphate kinase 3 (.1) AT4G23895 192 / 4e-60 Pleckstrin homology (PH) domain-containing protein (.1), Pleckstrin homology (PH) domain-containing protein (.2), Pleckstrin homology (PH) domain-containing protein (.3) AT1G17410 87 / 3e-22 Nucleoside diphosphate kinase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G049900 [exp] 283 / 4e-100 AT4G09320 242 / 2e-83 Nucleoside diphosphate kinase family protein (.1) Potri.012G093800 [exp] 202 / 2e-66 AT5G63310 281 / 1e-96 NDP KINASE 1A, NUCLEOSIDE DIPHOSPHATE KINASE IA, ARABIDOPSIS NUCLEOSIDE DIPHOSPHATE KINASE 2, nucleoside diphosphate kinase 2 (.1) Potri.001G091001 [exp] 191 / 3e-62 AT4G23900 335 / 2e-117 Nucleoside diphosphate kinase family protein (.1) Potri.003G140600 [exp] 187 / 7e-61 AT4G23900 332 / 2e-116 Nucleoside diphosphate kinase family protein (.1) Potri.003G068100 [exp] 84 / 9e-21 AT1G17410 229 / 1e-77 Nucleoside diphosphate kinase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024286 [exp] 259 / 2e-90 AT4G09320 272 / 3e-95 Nucleoside diphosphate kinase family protein (.1) Lus10003844 [exp] 251 / 2e-87 AT4G09320 264 / 7e-92 Nucleoside diphosphate kinase family protein (.1) Lus10032392 [exp] 191 / 5e-63 AT4G11010 328 / 1e-115 nucleoside diphosphate kinase 3 (.1) Lus10003878 [exp] 193 / 1e-62 AT4G23900 362 / 6e-128 Nucleoside diphosphate kinase family protein (.1) Lus10001824 [exp] 189 / 1e-61 AT4G23900 377 / 4e-134 Nucleoside diphosphate kinase family protein (.1) Lus10017931 [exp] 187 / 7e-61 AT5G63310 301 / 3e-104 NDP KINASE 1A, NUCLEOSIDE DIPHOSPHATE KINASE IA, ARABIDOPSIS NUCLEOSIDE DIPHOSPHATE KINASE 2, nucleoside diphosphate kinase 2 (.1) Lus10014787 [exp] 187 / 7e-61 AT5G63310 301 / 2e-104 NDP KINASE 1A, NUCLEOSIDE DIPHOSPHATE KINASE IA, ARABIDOPSIS NUCLEOSIDE DIPHOSPHATE KINASE 2, nucleoside diphosphate kinase 2 (.1) Lus10023076 [exp] 89 / 5e-22 AT4G23900 189 / 4e-59 Nucleoside diphosphate kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00334 [poplar] [flax] NDK Nucleoside diphosphate kinase
Representative CDS sequence Show only first row Show all	>Potri.002G138800.2 pacid=42778634 polypeptide=Potri.002G138800.2.p locus=Potri.002G138800 ID=Potri.002G138800.2.v4.1 annot-version=v4.1 ATGGAGCAAACCTTCATTATGATCAAGCCCGATGGCGTCCAAAGAGGACTCGTTGGTGAGATTATTTCAAGATTTGAGAAGAAGGGATTCACTCTCAAAG GTTTGAAGCTGCAGACTGTTGAGCAATCTTTTGCTGAGAAACACTACGAGGACCTGGCCAAGAAGCCATTCTTTGCCGGTCTTGTTCAGTATATTATTTC TGGCCCAGTTGTTGGAATGATTTGGGAGGGAAAAGGTGTTGTTGCCACTGGCCGTAAGATTATCGGAGCCACAAATCCTGCGGCTTCTGAACCTGGAACT ATCCGTGGTGATTTTGCTATTGATGTTGGGAGGAATGTTATTCATGGAAGCGACTCTGTTGAGAGTGCTACTAAGGAAATTGGACTGTGGTTCCCTGAGG GCCCTGCTAACTGGCAGAGCAGCCTGCACCCATGGATCTATGAGTAA
AA sequence Show only first row Show all	>Potri.002G138800.2 pacid=42778634 polypeptide=Potri.002G138800.2.p locus=Potri.002G138800 ID=Potri.002G138800.2.v4.1 annot-version=v4.1 MEQTFIMIKPDGVQRGLVGEIISRFEKKGFTLKGLKLQTVEQSFAEKHYEDLAKKPFFAGLVQYIISGPVVGMIWEGKGVVATGRKIIGATNPAASEPGT IRGDFAIDVGRNVIHGSDSVESATKEIGLWFPEGPANWQSSLHPWIYE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G09320		NDPK1	Nucleoside diphosphate kinase ...		Potri.002G138800 [exp]	0	1
AT5G28060			Ribosomal protein S24e family ...		Potri.005G049400 [exp]	6.16	0.7443	Pt-RPS24.1
AT4G15248	CO		B-box type zinc finger family ...		Potri.017G039400 [exp]	18.24	0.6818
AT3G56490		HIT3, HINT1	HISTIDINE TRIAD NUCLEOTIDE-BIN...		Potri.016G023700 [exp]	18.43	0.6648
AT1G67350			unknown protein		Potri.001G055400 [exp]	18.49	0.6638
AT1G14980		CPN10	chaperonin 10 (.1)		Potri.009G068900 [exp]	22.69	0.6955	CPN10.2
AT3G20390			endoribonuclease L-PSP family ...		Potri.001G435700 [exp]	23.32	0.6988
AT4G28440			Nucleic acid-binding, OB-fold-...		Potri.007G137600 [exp]	24.06	0.7143
					Potri.017G119700 [exp]	26.45	0.6852
AT1G52600			Peptidase S24/S26A/S26B/S26C f...		Potri.003G062800 [exp]	33.04	0.6289
AT5G16940			carbon-sulfur lyases (.1.2)		Potri.017G132000 [exp]	46.00	0.6339

Compare expression of checked genes

Potri.002G138800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.