Pt-RPS11.5 (Potri.002G140400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-RPS11.5
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23740 266 / 8e-93 RPS11-BETA ribosomal protein S11-beta (.1)
AT4G30800 266 / 8e-93 Nucleic acid-binding, OB-fold-like protein (.1)
AT3G48930 264 / 5e-92 EMB1080 embryo defective 1080, Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G053300 285 / 2e-100 AT5G23740 271 / 1e-94 ribosomal protein S11-beta (.1)
Potri.018G115400 276 / 8e-97 AT5G23740 271 / 5e-95 ribosomal protein S11-beta (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030113 279 / 8e-98 AT5G23740 282 / 4e-99 ribosomal protein S11-beta (.1)
Lus10001681 276 / 6e-97 AT5G23740 281 / 7e-99 ribosomal protein S11-beta (.1)
Lus10005348 276 / 1e-96 AT5G23740 282 / 2e-99 ribosomal protein S11-beta (.1)
Lus10041029 275 / 3e-96 AT5G23740 281 / 6e-99 ribosomal protein S11-beta (.1)
Lus10008806 277 / 2e-88 AT5G23740 282 / 1e-89 ribosomal protein S11-beta (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF00366 Ribosomal_S17 Ribosomal protein S17
Representative CDS sequence
>Potri.002G140400.1 pacid=42780159 polypeptide=Potri.002G140400.1.p locus=Potri.002G140400 ID=Potri.002G140400.1.v4.1 annot-version=v4.1
ATGGCTGAGCAGACGGAGAAGGCATTTTTGAAGCAGCCCAGGGTTTTCCTGAGCTCGAAGAAGTCTGGAAAGGGGAAGAGGCCCGGAAAGGGAGGAAATA
GGTTCTGGAAAAGCATTGGACTGGGATTCAAAACACCCAGAGATGCTATTGAAGGAACATACATTGATAAGAAATGCCCATTCACTGGCACTGTTTCTGT
CAGAGGACGTATCTTGGCTGGTACTTGCCACAGCGCAAAAATGAACAGAACCATTATTGTTAGGAGGAACTACCTTCACTGGGTCAAAAAATACCAGAGA
TATGAGAAGAGGCACTCAAACATCCCAGCTCACATCTCCCCCTGTTTCCGGATCAGAGAAGGAGATCATGTTACCATTGGTCAATGCAGGCCATTGTCCA
AGACAGTGAGGTTCAATGTGTTGAAGGTCATCCCAGCAGGATCTTCTGGTGGTGCAAAGAAGGCTTTTACAGCAATGTAA
AA sequence
>Potri.002G140400.1 pacid=42780159 polypeptide=Potri.002G140400.1.p locus=Potri.002G140400 ID=Potri.002G140400.1.v4.1 annot-version=v4.1
MAEQTEKAFLKQPRVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCPFTGTVSVRGRILAGTCHSAKMNRTIIVRRNYLHWVKKYQR
YEKRHSNIPAHISPCFRIREGDHVTIGQCRPLSKTVRFNVLKVIPAGSSGGAKKAFTAM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Potri.002G140400 0 1 Pt-RPS11.5
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.008G175500 3.00 0.9477
AT3G56340 Ribosomal protein S26e family ... Potri.019G057000 3.31 0.9636 RPS26.2
AT1G09690 Translation protein SH3-like f... Potri.003G159500 3.74 0.9621 RPL21.1
AT3G05560 Ribosomal L22e protein family ... Potri.014G128800 4.00 0.9571 RPL22.2
AT4G10450 Ribosomal protein L6 family (.... Potri.011G147700 4.24 0.9592 Pt-RPL9.4
AT5G57290 60S acidic ribosomal protein f... Potri.009G032600 5.00 0.9532
AT5G27700 Ribosomal protein S21e (.1) Potri.013G017600 5.91 0.9496
AT4G27090 Ribosomal protein L14 (.1) Potri.010G069900 7.34 0.9436
AT5G02960 Ribosomal protein S12/S23 fami... Potri.008G044400 9.00 0.9352 Pt-RPS23.3
AT5G62300 Ribosomal protein S10p/S20e fa... Potri.012G128300 9.16 0.9525 Pt-RPS20.1

Potri.002G140400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.