Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59970 62 / 1e-14 Histone superfamily protein (.1) AT5G59690 62 / 1e-14 Histone superfamily protein (.1) AT3G46320 62 / 1e-14 Histone superfamily protein (.1) AT3G53730 62 / 1e-14 Histone superfamily protein (.1) AT3G45930 62 / 1e-14 Histone superfamily protein (.1) AT2G28740 62 / 1e-14 HIS4 histone H4 (.1) AT1G07820 62 / 1e-14 Histone superfamily protein (.1.2) AT1G07660 62 / 1e-14 Histone superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G013500 [exp] 62 / 1e-14 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G012500 [exp] 62 / 1e-14 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.006G168100 [exp] 62 / 1e-14 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G214000 [exp] 62 / 1e-14 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G213900 [exp] 62 / 1e-14 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092900 [exp] 62 / 1e-14 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G093000 [exp] 62 / 1e-14 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092666 [exp] 62 / 1e-14 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.005G115300 [exp] 62 / 1e-14 AT5G59970 162 / 1e-53 Histone superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005448 [exp] 62 / 1e-14 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10041919 [exp] 62 / 1e-14 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10019956 [exp] 62 / 1e-14 AT3G46320 199 / 2e-68 Histone superfamily protein (.1) Lus10040849 [exp] 62 / 1e-14 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10038481 [exp] 62 / 1e-14 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10014264 [exp] 62 / 1e-14 AT5G59690 199 / 2e-68 Histone superfamily protein (.1) Lus10028464 [exp] 62 / 1e-14 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10025964 [exp] 62 / 1e-14 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10015492 [exp] 62 / 1e-14 AT1G07820 199 / 2e-68 Histone superfamily protein (.1.2) Lus10004949 [exp] 62 / 1e-14 AT3G53730 199 / 2e-68 Histone superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G143850.1 pacid=42777450 polypeptide=Potri.002G143850.1.p locus=Potri.002G143850 ID=Potri.002G143850.1.v4.1 annot-version=v4.1 ATGTACGGATGTGGAAAGGGAGGCGACGGTCTAGGAGAAGGAGGAGCCAAGCATGTTCGTGATAACATTCAAGATATCACAAAGCCTGTAACATGTTGTC TTGCTCGTAGGGGTGGAGTCAAGCGTATCAGTGGTTTGATCTATGAAGAGACTCGTGGTATTCTCAACTCTCAAGCTCTTCCCTGA
AA sequence Show only first row Show all	>Potri.002G143850.1 pacid=42777450 polypeptide=Potri.002G143850.1.p locus=Potri.002G143850 ID=Potri.002G143850.1.v4.1 annot-version=v4.1 MYGCGKGGDGLGEGGAKHVRDNIQDITKPVTCCLARRGGVKRISGLIYEETRGILNSQALP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59970			Histone superfamily protein (....		Potri.002G143850 [exp]	0	1
AT3G44680		HDA09, HDA9	histone deacetylase 9 (.1)		Potri.011G156250 [exp]	3.16	0.6319
AT5G40420		OLE2, PA23, OLE...	oleosin 2 (.1)		Potri.015G081901 [exp]	9.94	0.6343
AT1G43730			RNA-directed DNA polymerase (r...		Potri.016G103750 [exp]	12.48	0.6607
AT5G20710		BGAL7	beta-galactosidase 7 (.1)		Potri.018G062800 [exp]	13.49	0.6607
AT4G27650		PEL1	PELOTA, Eukaryotic release fac...		Potri.004G092600 [exp]	20.12	0.5955
AT2G35110		NAPP, GRL, NAP1	NCK-ASSOCIATED PROTEIN 1, GNAR...		Potri.015G123001 [exp]	29.46	0.4770
					Potri.010G154250 [exp]	29.93	0.5467
AT3G08690		ATUBC11, UBC11	ubiquitin-conjugating enzyme 1...		Potri.008G134400 [exp]	30.93	0.5384	Pt-UBC.3
					Potri.011G097050 [exp]	31.84	0.4602
AT5G12000			Protein kinase protein with ad...		Potri.001G198300 [exp]	43.26	0.4839

Compare expression of checked genes

Potri.002G143850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.