Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR20
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60690 174 / 3e-56 SAUR-like auxin-responsive protein family (.1) AT2G45210 160 / 2e-50 SAUR-like auxin-responsive protein family (.1) AT4G12410 122 / 7e-36 SAUR-like auxin-responsive protein family (.1) AT4G22620 118 / 4e-34 SAUR-like auxin-responsive protein family (.1) AT2G46690 88 / 1e-22 SAUR-like auxin-responsive protein family (.1) AT3G61900 87 / 3e-22 SAUR-like auxin-responsive protein family (.1) AT4G00880 82 / 1e-20 SAUR-like auxin-responsive protein family (.1) AT5G53590 79 / 5e-19 SAUR-like auxin-responsive protein family (.1) AT2G21210 73 / 3e-17 SAUR-like auxin-responsive protein family (.1) AT2G21220 71 / 2e-16 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G066900 [exp] 271 / 2e-94 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1) Potri.003G113100 [exp] 138 / 9e-42 AT4G12410 149 / 1e-46 SAUR-like auxin-responsive protein family (.1) Potri.001G119900 [exp] 135 / 8e-41 AT4G12410 140 / 8e-43 SAUR-like auxin-responsive protein family (.1) Potri.002G176400 [exp] 84 / 2e-21 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 84 / 3e-21 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 82 / 3e-20 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 78 / 5e-19 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 76 / 4e-18 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 74 / 2e-17 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009286 [exp] 191 / 1e-62 AT3G60690 150 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10015879 [exp] 188 / 2e-61 AT3G60690 151 / 7e-47 SAUR-like auxin-responsive protein family (.1) Lus10030295 [exp] 138 / 6e-42 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1) Lus10024600 [exp] 108 / 4e-30 AT4G12410 149 / 3e-46 SAUR-like auxin-responsive protein family (.1) Lus10032237 [exp] 100 / 1e-26 AT4G12410 149 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10004337 [exp] 94 / 6e-25 AT4G12410 110 / 2e-31 SAUR-like auxin-responsive protein family (.1) Lus10028920 [exp] 92 / 1e-24 AT4G12410 106 / 1e-30 SAUR-like auxin-responsive protein family (.1) Lus10001985 [exp] 89 / 1e-22 AT2G45210 93 / 2e-24 SAUR-like auxin-responsive protein family (.1) Lus10010110 [exp] 81 / 8e-20 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 74 / 4e-17 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.002G145300.1 pacid=42777265 polypeptide=Potri.002G145300.1.p locus=Potri.002G145300 ID=Potri.002G145300.1.v4.1 annot-version=v4.1 ATGATGAGAAAGAATAGAGGTTTCAAGATCGGCAAACGGTTTGTCCGGATCTCAACTTGGATCTTCAGTCGGACGCGGATCCACCCACCGGGTTGCAACT CCATAGGCCCATCAGAATCAACATGCAGTTCGAAGTCAAAGTCCTTATCGAAAATCATCAATTGGGGCCGTCGTTTAACAAAAGGAGCTAAATCAATTTG CAGTGCAAAACCCCGGTCGGGTTATATACCCGTGGGTCATGAACCGGTTTGTGATAAACCTGTTCCAGTACCAAAAGGGCATTTGGCTGTTTATGTGGGT CAAAAAGATGGTGAGTTTCATAGAGTTTTGGTGCCTTTGATTTATTTTAATCACCCTTTGTTTGGTGAATTATTAAGAGAAGCAGAAGAGGAATATGGTT TTAATCAACAAGGTGGGATTACCATTCCTTGCCGGTTTTCGGAGTTTGAGAGGGTCCAAACCCGGATTAAATCGGGGTCATGTGGAAGGAAGCTGACGTG GAAACGTAACCACCATTGA
AA sequence Show only first row Show all	>Potri.002G145300.1 pacid=42777265 polypeptide=Potri.002G145300.1.p locus=Potri.002G145300 ID=Potri.002G145300.1.v4.1 annot-version=v4.1 MMRKNRGFKIGKRFVRISTWIFSRTRIHPPGCNSIGPSESTCSSKSKSLSKIINWGRRLTKGAKSICSAKPRSGYIPVGHEPVCDKPVPVPKGHLAVYVG QKDGEFHRVLVPLIYFNHPLFGELLREAEEEYGFNQQGGITIPCRFSEFERVQTRIKSGSCGRKLTWKRNHH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60690			SAUR-like auxin-responsive pro...		Potri.002G145300 [exp]	0	1	SAUR20
AT3G21750		UGT71B1	UDP-glucosyl transferase 71B1 ...		Potri.016G017100 [exp]	4.00	0.9556
AT2G43000	NAC	ANAC042, JUB1, ...	NAC domain containing protein ...		Potri.005G205400 [exp]	5.19	0.9558
AT5G27060		AtRLP53	receptor like protein 53 (.1)		Potri.011G054500 [exp]	5.83	0.9606
AT3G22370		AtHSR3, ATAOX1A...	hyper-sensitivity-related 3, a...		Potri.015G019800 [exp]	5.91	0.9508
AT5G53588		CPuORF50	conserved peptide upstream ope...		Potri.002G145251 [exp]	6.24	0.9451
					Potri.017G111100 [exp]	10.48	0.9492
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.012G025400 [exp]	10.95	0.9508
AT1G76360			Protein kinase superfamily pro...		Potri.002G009400 [exp]	12.00	0.9505
AT3G47570			Leucine-rich repeat protein ki...		Potri.004G060100 [exp]	13.22	0.9281
					Potri.004G104600 [exp]	14.69	0.9324

Compare expression of checked genes

Potri.002G145300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.