Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60740 67 / 7e-15 TFCD, EMB133, CHO, TTN1 TITAN 1, TUBULIN FOLDING COFACTOR D, EMBRYO DEFECTIVE 133, CHAMPIGNON, ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G067400 [exp] 79 / 8e-19 AT3G60740 1664 / 0.0 TITAN 1, TUBULIN FOLDING COFACTOR D, EMBRYO DEFECTIVE 133, CHAMPIGNON, ARM repeat superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030293 [exp] 71 / 4e-16 AT3G60740 1647 / 0.0 TITAN 1, TUBULIN FOLDING COFACTOR D, EMBRYO DEFECTIVE 133, CHAMPIGNON, ARM repeat superfamily protein (.1) Lus10001987 [exp] 61 / 2e-12 AT3G60740 1185 / 0.0 TITAN 1, TUBULIN FOLDING COFACTOR D, EMBRYO DEFECTIVE 133, CHAMPIGNON, ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G145750.1 pacid=42778169 polypeptide=Potri.002G145750.1.p locus=Potri.002G145750 ID=Potri.002G145750.1.v4.1 annot-version=v4.1 ATGCCTGCCCCAACGGAAGATGAACACGACTCGAAAGAGAGATTTCTCCGAAAACAATTCTTACAAGAATGGAAACTCGTCAAATCTCTCCTTGACGACA TCGTTTCTAATCAACAACTCTCCGATCTCTCTTCCGTCCACAAGACCCGCTTCATTGCTATGTATGGTTACTCTTCACCAAATACAGAAATGGCATTACC AGAGACGGCAGCACACGTGAATAAAAATAGTTAA
AA sequence Show only first row Show all	>Potri.002G145750.1 pacid=42778169 polypeptide=Potri.002G145750.1.p locus=Potri.002G145750 ID=Potri.002G145750.1.v4.1 annot-version=v4.1 MPAPTEDEHDSKERFLRKQFLQEWKLVKSLLDDIVSNQQLSDLSSVHKTRFIAMYGYSSPNTEMALPETAAHVNKNS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60740		TFCD, EMB133, C...	TITAN 1, TUBULIN FOLDING COFAC...		Potri.002G145750 [exp]	0	1
AT4G38210		ATHEXPALPHA1.23...	EXPANSIN 20, expansin A20 (.1)		Potri.009G169500 [exp]	6.16	0.7109	PtrEXPA21,ATEXPA20.1
					Potri.001G132850 [exp]	9.59	0.6901
AT1G63450		RHS8	root hair specific 8 (.1)		Potri.003G126001 [exp]	11.40	0.6284
AT1G20030			Pathogenesis-related thaumatin...		Potri.001G220900 [exp]	17.05	0.6929
AT5G49525			unknown protein		Potri.013G007500 [exp]	28.19	0.6880
AT2G45260			Plant protein of unknown funct...		Potri.019G128300 [exp]	29.73	0.5768
AT1G52520	FAR1_related	FRS6	FAR1-related sequence 6 (.1)		Potri.003G031500 [exp]	35.49	0.6815
AT4G33625			unknown protein		Potri.007G115800 [exp]	43.41	0.6225
AT2G03550			alpha/beta-Hydrolases superfam...		Potri.009G105100 [exp]	55.45	0.6197
AT4G11410			NAD(P)-binding Rossmann-fold s...		Potri.003G128901 [exp]	62.03	0.5975

Compare expression of checked genes

Potri.002G145750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.