Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00080 164 / 6e-51 UNE11 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 138 / 3e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 136 / 2e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 134 / 3e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 131 / 2e-38 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 128 / 5e-37 PME1 pectin methylesterase inhibitor 1 (.1) AT5G62360 117 / 9e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 112 / 6e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 104 / 7e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 100 / 7e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G067500 [exp] 320 / 3e-112 AT4G00080 156 / 1e-47 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 158 / 6e-49 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128700 [exp] 154 / 2e-47 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 147 / 1e-44 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.015G128100 [exp] 121 / 2e-34 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 119 / 1e-33 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 115 / 5e-32 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G119300 [exp] 114 / 8e-32 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 109 / 6e-30 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030292 [exp] 187 / 5e-60 AT4G00080 158 / 1e-48 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001988 [exp] 182 / 3e-58 AT4G00080 154 / 5e-47 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031133 [exp] 149 / 3e-45 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 140 / 7e-42 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 133 / 5e-39 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 132 / 5e-39 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10032230 [exp] 114 / 2e-31 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10024593 [exp] 111 / 1e-30 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 107 / 9e-29 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 100 / 3e-26 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.002G145800.1 pacid=42779268 polypeptide=Potri.002G145800.1.p locus=Potri.002G145800 ID=Potri.002G145800.1.v4.1 annot-version=v4.1 ATGAATCGTCTCAGCCTTTCCATACCGCTACTGCTGCTATCCATATTTTGCTTTTCAGGCACAGTGGAACCGGCAAGGTTTGCCAGACATTCCCGGCCTC GGGCCTATATCGAGACTGCGTGCACGAAGACCCTTTATCCATCCCTATGCACCCAATACCTATCAGTCTTTGCAAACTCAACAATACAAACCCCTCAACA ACTAGCCCAAGCTGCCTTATCCGTGAGCCTATACAAGGCCCTCCAAACAAGAACATTCATGTTGAAAGTGGTCAAGGAGCTCAAGGCAATGAAATCTAAG GATTACCAGGCTGTGAAGGACTGCTTGGATCAAATTGGTGATAGCGTGGATCAACTTAGCCAATCAGTTAGAGAGCTCCATCGCTTGGAACATCCAGGTG CTGCGGGTGGCGGTGACGTCTTTTGGCACGTAAGTAATTTCGAGACCTGGGTAAGCTCTGCCATGACTGATGCCAGTACTTGTGTGGATGAGTTACCGGG GAAGGATATGAACAAGTTAAAGGCTGTAATCAAGGCCAAGGTTTTGAATGTGGCACAGACTGCTAGCAATGCACTAGCCTTGTTTCAGCGGTACGCTGCA AAGCACAAGCCATAA
AA sequence Show only first row Show all	>Potri.002G145800.1 pacid=42779268 polypeptide=Potri.002G145800.1.p locus=Potri.002G145800 ID=Potri.002G145800.1.v4.1 annot-version=v4.1 MNRLSLSIPLLLLSIFCFSGTVEPARFARHSRPRAYIETACTKTLYPSLCTQYLSVFANSTIQTPQQLAQAALSVSLYKALQTRTFMLKVVKELKAMKSK DYQAVKDCLDQIGDSVDQLSQSVRELHRLEHPGAAGGGDVFWHVSNFETWVSSAMTDASTCVDELPGKDMNKLKAVIKAKVLNVAQTASNALALFQRYAA KHKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G00080		UNE11	unfertilized embryo sac 11, Pl...		Potri.002G145800 [exp]	0	1
AT4G34215			Domain of unknown function (DU...		Potri.001G300800 [exp]	2.44	0.7393
AT1G08760			Plant protein of unknown funct...		Potri.007G131600 [exp]	7.93	0.7294
AT1G34260		FAB1D	FORMS APLOID AND BINUCLEATE CE...		Potri.019G087000 [exp]	8.24	0.7220
AT1G62400		HT1	high leaf temperature 1, Prote...		Potri.015G075200 [exp]	18.89	0.6617
AT1G09890			Rhamnogalacturonate lyase fami...		Potri.002G110100 [exp]	19.74	0.7038
					Potri.002G169550 [exp]	22.13	0.6875
AT5G16490		RIC4	ROP-interactive CRIB motif-con...		Potri.013G086600 [exp]	29.79	0.6957
AT4G34280			transducin family protein / WD...		Potri.009G092500 [exp]	33.86	0.6461
AT3G13410			unknown protein		Potri.003G223601 [exp]	33.98	0.7029
AT2G43980		ATITPK4	"inositol 1,3,4-trisphosphate ...		Potri.007G144701 [exp]	34.95	0.6516

Compare expression of checked genes

Potri.002G145800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.