Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PBF1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60820 387 / 1e-138 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G21720 79 / 4e-18 PBC1 proteasome beta subunit C1 (.1) AT1G77440 77 / 3e-17 PBC2 20S proteasome beta subunit C2 (.1.2) AT4G31300 57 / 6e-10 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G069800 [exp] 451 / 5e-164 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.002G080800 [exp] 88 / 2e-21 AT1G21720 383 / 1e-137 proteasome beta subunit C1 (.1) Potri.005G180500 [exp] 87 / 5e-21 AT1G21720 391 / 9e-141 proteasome beta subunit C1 (.1) Potri.006G077900 [exp] 62 / 1e-11 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.008G155500 [exp] 52 / 4e-08 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1) Potri.010G084800 [exp] 50 / 1e-07 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015867 [exp] 395 / 1e-141 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10009294 [exp] 334 / 3e-109 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1) Lus10000062 [exp] 240 / 8e-82 AT3G60820 232 / 6e-79 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10004024 [exp] 174 / 1e-54 AT3G60820 190 / 4e-61 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10030272 [exp] 83 / 1e-20 AT3G60820 81 / 2e-20 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10030271 [exp] 81 / 3e-20 AT3G60820 82 / 3e-21 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10020599 [exp] 73 / 8e-16 AT1G21720 355 / 7e-127 proteasome beta subunit C1 (.1) Lus10004885 [exp] 72 / 2e-15 AT1G21720 356 / 2e-127 proteasome beta subunit C1 (.1) Lus10020180 [exp] 57 / 2e-09 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10041194 [exp] 52 / 3e-08 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF00227 [poplar] [flax] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Potri.002G148300.4 pacid=42777602 polypeptide=Potri.002G148300.4.p locus=Potri.002G148300 ID=Potri.002G148300.4.v4.1 annot-version=v4.1 ATGACTAAACAACAAGCCAGATTTGAACCCTACGATTTTAATGGAGGGACTTGCGTTGCGATTGCTGGAGCTGATTACTGTGTAGTCGCCGCTGATACTC GAATGTCTACCGGATACAATATTCTCACTCGCGATTACTCCAAAATCTATAAATTAGCGGACAAGTGTTTAATGGCCTCTTCTGGCTTTCAAGCTGATGT GAGAGCCCTACAAAAGGTTTTGGGGGCTAAGCACCTGATCTATCAACATCAACACAACAAGCAGATGAGCTGCCCTGCCATGGCTCGACTTCTCTCCAAC ACTCTCTACTACAAACGTTTCTTCCCTTATTATACCTTCAACGTTTTGGTTGGCTTTGATGAGGAAGGAAAGGGCTGTGTTTACACTTACGATGCTGTCG GTTCCTATGAGAAGGTTGGGTATAGTGCCCAAGGTTCTGGTGCTAAACTCATCATGCCTGTGCTAGATAACCAGCTGAAGTCCCCCAGCCCTCTTTTATT ACCTGCGCAGGACGCTGTAACTCCACTTTCTGAGGCAGAAGCAATTGATGTGGTCAAAGATGTTTTTGCATCTGCAACTGAGAGGGATATATACACTGGA GACAAGCTTGAAATTGTCATCTTAAATGCTGATGGTATGCGTCGTGAATATGCAGAGCTCAGAAAAGATTGA
AA sequence Show only first row Show all	>Potri.002G148300.4 pacid=42777602 polypeptide=Potri.002G148300.4.p locus=Potri.002G148300 ID=Potri.002G148300.4.v4.1 annot-version=v4.1 MTKQQARFEPYDFNGGTCVAIAGADYCVVAADTRMSTGYNILTRDYSKIYKLADKCLMASSGFQADVRALQKVLGAKHLIYQHQHNKQMSCPAMARLLSN TLYYKRFFPYYTFNVLVGFDEEGKGCVYTYDAVGSYEKVGYSAQGSGAKLIMPVLDNQLKSPSPLLLPAQDAVTPLSEAEAIDVVKDVFASATERDIYTG DKLEIVILNADGMRREYAELRKD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60820		PBF1	N-terminal nucleophile aminohy...		Potri.002G148300 [exp]	0	1	Pt-PBF1.1
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Potri.005G054500 [exp]	3.87	0.7740
AT4G19003		VPS25	E2F/DP family winged-helix DNA...		Potri.001G135700 [exp]	4.00	0.7281
AT3G26340			N-terminal nucleophile aminohy...		Potri.010G058100 [exp]	4.24	0.8418	PBE1.1
AT5G56280		CSN6A	COP9 signalosome subunit 6A (....		Potri.011G169900 [exp]	5.19	0.7491	Pt-CSN6.1
AT5G65650			Protein of unknown function (D...		Potri.007G027700 [exp]	5.38	0.6992
AT1G45000			AAA-type ATPase family protein...		Potri.002G031400 [exp]	5.47	0.7821	RPT4.2
AT3G51260		PAD1	20S proteasome alpha subunit ...		Potri.004G174200 [exp]	9.05	0.7988	Pt-PAD1.2
AT1G79010			Alpha-helical ferredoxin (.1)		Potri.009G116000 [exp]	9.79	0.7798
AT5G08060			unknown protein		Potri.004G123700 [exp]	10.39	0.7336
AT4G39220		ATRER1A	Rer1 family protein (.1)		Potri.007G047800 [exp]	10.95	0.7119

Compare expression of checked genes

Potri.002G148300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.