Potri.002G148550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G069900 137 / 7e-41 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G148550.1 pacid=42779747 polypeptide=Potri.002G148550.1.p locus=Potri.002G148550 ID=Potri.002G148550.1.v4.1 annot-version=v4.1
ATGAGGATTAGAGAGCCTACAGTCATTTGTATCATCTTCTCTTTGTTACTCTCAATATCTAAGCATAACAACCTTCATTTCTCTAGCTATGACTTCATTA
TCGTGGCAAAACCTAGCCTTGTAACTTTGTTTTTCATGTTCCACTTTATCATGATCACCATCTTTATAGGAAGCTCTAAGCCGCCATCAGTAGAAAATCT
TGAGTACTCGTTTTCTTCTCTCACTCCTCCAAGGTATGAAATGGACCAAACAATACAAAACGTTGAAGTTTGTGGTAGCACTAGCACTGATGATGAGGAT
GATGATCAGAGCTATAATTCTGATGGTTATCATGATGATAGCTATCATGGTTCTGATGAATATGATGAAGAAAATGACGATGATGTTATTGATACAGAAG
GTAAAGACAGTGAAGATGAAGAATATGATAATAAGTTGGAGAAGAAAATAGAGGGATTTATAGCGAAGGTTTATCAGAAAAGGAGGGAGGAGTTTCTCGG
AGACAGGCTTCTTTGTATAACTGCTGGTTAG
AA sequence
>Potri.002G148550.1 pacid=42779747 polypeptide=Potri.002G148550.1.p locus=Potri.002G148550 ID=Potri.002G148550.1.v4.1 annot-version=v4.1
MRIREPTVICIIFSLLLSISKHNNLHFSSYDFIIVAKPSLVTLFFMFHFIMITIFIGSSKPPSVENLEYSFSSLTPPRYEMDQTIQNVEVCGSTSTDDED
DDQSYNSDGYHDDSYHGSDEYDEENDDDVIDTEGKDSEDEEYDNKLEKKIEGFIAKVYQKRREEFLGDRLLCITAG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G148550 0 1
AT4G03390 SRF3 STRUBBELIG-receptor family 3 (... Potri.013G144600 1.41 0.7115
Potri.016G103700 10.86 0.7616
AT1G78540 STATLB, ATSHB STAT-TYPE LINKER-SH2 DOMAIN FA... Potri.001G380900 23.49 0.6486
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Potri.011G027800 31.49 0.6987
AT1G08650 ATPPCK1, PPCK1 phosphoenolpyruvate carboxylas... Potri.008G166500 38.49 0.6616
AT4G23280 CRK20 cysteine-rich RLK (RECEPTOR-li... Potri.011G027600 43.78 0.6869
AT1G15100 RHA2A RING-H2 finger A2A (.1) Potri.007G086200 44.89 0.6876
Potri.001G259204 53.55 0.6827
AT2G23140 RING/U-box superfamily protein... Potri.006G251000 65.23 0.6563
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Potri.011G027900 72.49 0.6624

Potri.002G148550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.