Potri.002G149600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60890 64 / 2e-14 ZPR2 LITTLE ZIPPER 2, protein binding (.1.2)
AT3G52770 45 / 1e-07 ZPR3 LITTLE ZIPPER 3, protein binding (.1)
AT2G45450 47 / 2e-07 ZPR1 LITTLE ZIPPER 1, protein binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G071200 145 / 1e-46 AT3G60890 62 / 1e-13 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.003G117200 65 / 9e-15 AT3G60890 63 / 4e-14 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.001G114900 57 / 2e-11 AT3G60890 57 / 1e-11 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.006G083201 50 / 1e-08 AT3G52770 54 / 2e-10 LITTLE ZIPPER 3, protein binding (.1)
Potri.008G021766 39 / 3e-05 AT3G52770 51 / 1e-10 LITTLE ZIPPER 3, protein binding (.1)
Potri.010G237600 39 / 3e-05 AT3G52770 49 / 7e-10 LITTLE ZIPPER 3, protein binding (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028902 62 / 2e-13 AT3G60890 59 / 1e-12 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10008913 59 / 1e-12 AT3G60890 58 / 2e-12 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10006673 59 / 2e-12 AT3G60890 47 / 4e-08 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10007017 58 / 5e-12 AT3G60890 48 / 3e-08 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10021375 51 / 2e-09 AT3G52770 77 / 3e-20 LITTLE ZIPPER 3, protein binding (.1)
Lus10017055 48 / 4e-08 AT3G52770 77 / 5e-20 LITTLE ZIPPER 3, protein binding (.1)
Lus10022725 44 / 9e-07 AT3G52770 73 / 5e-19 LITTLE ZIPPER 3, protein binding (.1)
Lus10014188 42 / 2e-06 AT3G52770 72 / 1e-18 LITTLE ZIPPER 3, protein binding (.1)
PFAM info
Representative CDS sequence
>Potri.002G149600.1 pacid=42776726 polypeptide=Potri.002G149600.1.p locus=Potri.002G149600 ID=Potri.002G149600.1.v4.1 annot-version=v4.1
ATGAGTGCTAGTACATGTTCAAAACTGAGCCCATGCAGTCCCTTGTATATTGCTTTTAGCAATCAACAGCCATCAAAAGGACACAGCCTTCGATATCACA
GGCTAAACAGGAAGAGAAGGTTGACCAAACAAACTAAGGAGAAGAAGATGGCTGTACTGGTAAAGAAAGAGATGGAAATCAAGAACTTGAAACTGTACAT
GGAGAACAAAAGCATCATAGAAGAGAATGAGAAGCTGAGGAAGAAAGCACTCCTTCTACACCAAGAAAATCAAGCTCTGTCTTACCTGCTCCAAAAGAAG
TCCTCCAATACTCTTCATGACCACTTGGCTCCCAACAACTAA
AA sequence
>Potri.002G149600.1 pacid=42776726 polypeptide=Potri.002G149600.1.p locus=Potri.002G149600 ID=Potri.002G149600.1.v4.1 annot-version=v4.1
MSASTCSKLSPCSPLYIAFSNQQPSKGHSLRYHRLNRKRRLTKQTKEKKMAVLVKKEMEIKNLKLYMENKSIIEENEKLRKKALLLHQENQALSYLLQKK
SSNTLHDHLAPNN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G60890 ZPR2 LITTLE ZIPPER 2, protein bindi... Potri.002G149600 0 1
AT4G35900 bZIP ATBZIP14, FD-1,... Basic-leucine zipper (bZIP) tr... Potri.005G243400 1.73 0.8061
AT3G08860 PYD4 PYRIMIDINE 4 (.1) Potri.006G106800 2.44 0.7905
AT4G18020 GARP APRR2 PSEUDO-RESPONSE REGULATOR 2, C... Potri.003G087700 3.16 0.8500 PtpRR10
AT3G11760 unknown protein Potri.010G244100 3.46 0.8246
AT5G07050 nodulin MtN21 /EamA-like trans... Potri.006G033500 10.24 0.7946
AT2G26270 unknown protein Potri.006G218800 10.39 0.7459
AT2G37900 Major facilitator superfamily ... Potri.006G092000 10.90 0.7902
AT2G41370 BOP2 BLADE ON PETIOLE2, Ankyrin rep... Potri.006G043400 12.68 0.7496
AT3G48660 Protein of unknown function (D... Potri.015G098300 15.16 0.7831
AT1G49310 unknown protein Potri.004G153200 15.29 0.7473

Potri.002G149600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.