Potri.002G151500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G45640 185 / 3e-61 ATSAP18, HDA19 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G074000 213 / 2e-72 AT2G45640 163 / 1e-52 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
Potri.003G119300 194 / 2e-64 AT2G45640 182 / 1e-59 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041388 223 / 2e-75 AT2G45640 168 / 5e-54 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
Lus10036540 216 / 9e-67 AT3G61130 1015 / 0.0 galacturonosyltransferase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Representative CDS sequence
>Potri.002G151500.1 pacid=42779866 polypeptide=Potri.002G151500.1.p locus=Potri.002G151500 ID=Potri.002G151500.1.v4.1 annot-version=v4.1
ATGGCGGGAATGGCAGAAATGCAGAGGAGACAAGGAGGTAGACCATTTGCTCTTACTGCAAGAGCTTTTCCTCCTCCTCCTCCTCCTCCTCCTCCTATTG
ATCGTGAGAAGACATGTCCCCTATTGCTTCGGGTTTTCACTAAGATTGGAGATCATCATAGCAACGAGGATTTTGCAGTGAGAGGCAAGGAGCCGAAAGA
TGAGGTTCAAATTTATACGTGGAAGGATGCCACTCTTCGCGAGTTAACTGATCTGGTCAAAGAGGTGACTCCAGCAGCTAGGAGAAGAGATGCAAGACTG
TCCTTTGCTTTTGTATATCCTGATAAAAATGGTCGTTTTGTAGTACGAGAGGTGGGCAAGACCAATTCTCATAGAAATGGGAAATTCGATGACAACAAAG
CATTGGCTCAGCTTGGCTTCCAGATTGGGGATTACTTGGATGTGGCAATTTTTTAG
AA sequence
>Potri.002G151500.1 pacid=42779866 polypeptide=Potri.002G151500.1.p locus=Potri.002G151500 ID=Potri.002G151500.1.v4.1 annot-version=v4.1
MAGMAEMQRRQGGRPFALTARAFPPPPPPPPPIDREKTCPLLLRVFTKIGDHHSNEDFAVRGKEPKDEVQIYTWKDATLRELTDLVKEVTPAARRRDARL
SFAFVYPDKNGRFVVREVGKTNSHRNGKFDDNKALAQLGFQIGDYLDVAIF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G45640 ATSAP18, HDA19 SIN3 ASSOCIATED POLYPEPTIDE 18... Potri.002G151500 0 1
AT3G05000 Transport protein particle (TR... Potri.005G044300 5.00 0.7822
AT3G12260 LYR family of Fe/S cluster bio... Potri.001G029900 27.22 0.7728
AT1G21930 unknown protein Potri.002G086300 33.64 0.7604
AT5G22280 unknown protein Potri.006G206100 34.98 0.6411
AT3G22845 emp24/gp25L/p24 family/GOLD fa... Potri.010G081700 36.26 0.7539
AT5G40080 Mitochondrial ribosomal protei... Potri.005G161600 43.95 0.6928
AT1G48440 B-cell receptor-associated 31-... Potri.012G042700 46.15 0.7011
AT2G36300 Integral membrane Yip1 family ... Potri.004G190800 60.73 0.7274
AT2G29540 ATRPAC14, ATRPC... RNApolymerase 14 kDa subunit (... Potri.001G246600 63.63 0.6487 Pt-ATRPC14.1
AT1G69460 emp24/gp25L/p24 family/GOLD fa... Potri.010G164600 63.87 0.6807

Potri.002G151500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.