Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01850 105 / 5e-27 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1) AT1G14720 103 / 4e-26 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1) AT4G18990 102 / 8e-26 XTH29, XTR13 xyloglucan endotransglucosylase/hydrolase 29 (.1) AT1G10550 98 / 2e-24 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1) AT2G36870 97 / 5e-24 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) AT2G18800 96 / 1e-23 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1) AT4G30270 95 / 1e-23 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT1G32170 96 / 2e-23 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1) AT5G48070 95 / 2e-23 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT4G03210 95 / 3e-23 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G138400 [exp] 104 / 1e-26 AT1G14720 467 / 2e-166 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1) Potri.010G102300 [exp] 103 / 3e-26 AT1G14720 470 / 7e-168 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1) Potri.006G071200 [exp] 98 / 1e-24 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.013G005700 [exp] 97 / 1e-23 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.003G097300 [exp] 97 / 1e-23 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1) Potri.018G094900 [exp] 95 / 2e-23 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 94 / 3e-23 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 94 / 4e-23 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.016G098600 [exp] 94 / 5e-23 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041373 [exp] 150 / 1e-46 ND 39 / 3e-04 Lus10013822 [exp] 103 / 1e-26 AT2G36870 444 / 1e-158 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10026535 [exp] 103 / 1e-26 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10020772 [exp] 102 / 5e-26 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10007349 [exp] 101 / 9e-26 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10013240 [exp] 102 / 1e-25 AT2G01850 456 / 2e-162 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1) Lus10030760 [exp] 101 / 2e-25 AT1G14720 456 / 3e-162 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1) Lus10030484 [exp] 100 / 3e-25 AT4G25810 398 / 9e-141 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Lus10023009 [exp] 100 / 4e-25 AT2G36870 466 / 3e-167 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10001396 [exp] 100 / 4e-25 AT2G36870 460 / 8e-165 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16
Representative CDS sequence Show only first row Show all	>Potri.002G153200.1 pacid=42778835 polypeptide=Potri.002G153200.1.p locus=Potri.002G153200 ID=Potri.002G153200.1.v4.1 annot-version=v4.1 ATGGCGGATCCAGCAATCCACCACGAGACCCAACCCATTAACCAAATCGCCATAGACTACACCCCAGAGGCATGCACTCACTGCCCGGAGTCCAATTCCA TCACTCTCACATACGACCACCGTGGGGGCGCACGGTGGCGCAGTACCACCCGTTTTCTTTACGGCACTTTCAGTTCTCTCATCCAATGTCCCAAAGGTAA CACGAGTGGCCTTAACTTCAACATCTATCTTTCTTCTCTTGAAGGTGACAAATCCCAAGATGAGATCGACTTTGAGTTTCTTGGTAAAGACAAGACCATC GTACAAACTAATTACTACGCTTCAGGGACTGGGAACAGAGAAGAAATTCATGATCTGGGGTTTGATTGTTCTGATGCGTTTCATGAGTATGTAATAAAGT GGTGTCCAAATTTCATAGAGTGGTTGATTGATGGAAAAGTGGTGAGGAAAGTGGAGAAAAGGGAAGGGGAGGGATTCCCTGAGAAACCCATGTTTTTGTA TGCTTCAATTTGGGATGCAAGCTACATTGGTGACGCAACTTGGACTGGACCGTATATGGGGTGTGATGCACCTTATCTTTGTCTCTACAAGGACATTTGT GTGCCTGTTGGGACTGCGGTGGAGTGTTCTTGTGATTCTTGA
AA sequence Show only first row Show all	>Potri.002G153200.1 pacid=42778835 polypeptide=Potri.002G153200.1.p locus=Potri.002G153200 ID=Potri.002G153200.1.v4.1 annot-version=v4.1 MADPAIHHETQPINQIAIDYTPEACTHCPESNSITLTYDHRGGARWRSTTRFLYGTFSSLIQCPKGNTSGLNFNIYLSSLEGDKSQDEIDFEFLGKDKTI VQTNYYASGTGNREEIHDLGFDCSDAFHEYVIKWCPNFIEWLIDGKVVRKVEKREGEGFPEKPMFLYASIWDASYIGDATWTGPYMGCDAPYLCLYKDIC VPVGTAVECSCDS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G01850		ATXTH27, EXGT-A...	XYLOGLUCAN ENDOTRANSGLUCOSYLAS...		Potri.002G153200 [exp]	0	1
					Potri.004G047566 [exp]	2.44	0.7659
AT5G23300		PYRD	pyrimidine d (.1)		Potri.007G074101 [exp]	5.47	0.7442
AT5G65550			UDP-Glycosyltransferase superf...		Potri.008G024801 [exp]	6.48	0.7570
AT4G03140			NAD(P)-binding Rossmann-fold s...		Potri.014G135510 [exp]	14.14	0.7539
					Potri.010G183951 [exp]	16.30	0.7333
AT2G45640		ATSAP18, HDA19	SIN3 ASSOCIATED POLYPEPTIDE 18...		Potri.014G074000 [exp]	17.49	0.7323
AT2G36026	OFP		Ovate family protein (.1)		Potri.016G072800 [exp]	19.62	0.7272
AT5G20810			SAUR-like auxin-responsive pro...		Potri.018G063400 [exp]	22.97	0.7390
					Potri.005G221050 [exp]	30.16	0.7214
					Potri.004G191742 [exp]	32.46	0.7069

Compare expression of checked genes

Potri.002G153200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.