Potri.002G153400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20030 84 / 4e-19 RING/U-box superfamily protein (.1)
AT4G10150 81 / 1e-18 RING/U-box superfamily protein (.1)
AT4G33565 82 / 2e-18 RING/U-box superfamily protein (.1)
AT4G10160 81 / 2e-18 RING/U-box superfamily protein (.1)
AT3G62690 80 / 3e-18 ATL5 AtL5 (.1)
AT1G04360 81 / 8e-18 RING/U-box superfamily protein (.1)
AT5G43420 79 / 2e-17 RING/U-box superfamily protein (.1)
AT4G17905 79 / 2e-17 ATL4H RING/U-box superfamily protein (.1)
AT2G46160 77 / 2e-17 RING/U-box superfamily protein (.1)
AT1G20823 77 / 2e-17 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G076800 360 / 1e-128 AT4G10150 84 / 1e-19 RING/U-box superfamily protein (.1)
Potri.010G235200 164 / 1e-50 AT1G20823 80 / 3e-18 RING/U-box superfamily protein (.1)
Potri.008G025300 162 / 3e-50 AT4G40070 86 / 7e-20 RING/U-box superfamily protein (.1)
Potri.010G243300 84 / 2e-20 AT2G35910 115 / 2e-32 RING/U-box superfamily protein (.1)
Potri.019G043900 85 / 6e-20 AT3G03550 223 / 3e-71 RING/U-box superfamily protein (.1)
Potri.007G097500 83 / 1e-18 AT5G10380 145 / 2e-40 RING/U-box superfamily protein (.1)
Potri.007G111900 82 / 1e-18 AT4G33565 163 / 1e-46 RING/U-box superfamily protein (.1)
Potri.002G039700 81 / 4e-18 AT5G43420 246 / 4e-79 RING/U-box superfamily protein (.1)
Potri.008G018900 78 / 4e-18 AT2G35910 100 / 2e-26 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043426 145 / 2e-43 AT4G40070 84 / 5e-19 RING/U-box superfamily protein (.1)
Lus10034157 145 / 2e-43 AT4G40070 84 / 7e-19 RING/U-box superfamily protein (.1)
Lus10013618 82 / 2e-18 AT5G17600 220 / 1e-69 RING/U-box superfamily protein (.1)
Lus10009511 81 / 9e-18 AT2G20030 228 / 3e-71 RING/U-box superfamily protein (.1)
Lus10041079 77 / 3e-17 AT3G61550 239 / 1e-80 RING/U-box superfamily protein (.1)
Lus10034953 79 / 4e-17 AT2G20030 278 / 2e-90 RING/U-box superfamily protein (.1)
Lus10012975 79 / 4e-17 AT2G20030 291 / 2e-95 RING/U-box superfamily protein (.1)
Lus10016163 77 / 4e-17 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1)
Lus10006493 77 / 6e-17 AT3G16720 221 / 5e-71 TOXICOS EN LEVADURA 2 (.1)
Lus10012745 77 / 8e-17 AT4G33565 168 / 4e-49 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.002G153400.1 pacid=42778227 polypeptide=Potri.002G153400.1.p locus=Potri.002G153400 ID=Potri.002G153400.1.v4.1 annot-version=v4.1
ATGTTTGGTGCAACTATGAATTTAATCACAACAGCTATTGGTTTTGGTATGAGTGCTACTTTTATTGTGTTTGTTTGTGCAAGAATTATATGTGGGAGGA
TAAGAGGTACTGAGTCCAGGCAAATGTTTGAAATTGAGTCCAGAATTGATCCTGAACAGCCAGAGCATCGTATTGGTGGTCTTGAACCAGTTCTGCTTGC
TGCAATCCCCACTCTACGGTTCACCCATGAGGAATTCAGTTCTGCAGAAGATGCACAGTGCTCCATATGTTTAGGGGAATACCAAGAAAAGGAAGTATTA
AGAATCATGCCCGGATGCGGCCACAACTTCCATCTCTCTTGCATTGATGTATGGCTAAGAAAACAGTCTACATGCCCAGTCTGTCGGTTCCCAATACAAG
ATTCTTTTGAAGCAAAGCACATGAGACAGACAGCAATCAGTATGGTCCAATCAATTGATAGTCCTGATACTCGAAGTGAACAATCTCGGCAATGGCTGCT
GCCCAGCTATCAGGGTTCAGCGGGGAACCACAGTAATCAAAGGCATCTTGACCCTGTTCCTGGAAACCCTGAAATTACTCCTGGAGAATCACAAACAAGC
CGTTCATGA
AA sequence
>Potri.002G153400.1 pacid=42778227 polypeptide=Potri.002G153400.1.p locus=Potri.002G153400 ID=Potri.002G153400.1.v4.1 annot-version=v4.1
MFGATMNLITTAIGFGMSATFIVFVCARIICGRIRGTESRQMFEIESRIDPEQPEHRIGGLEPVLLAAIPTLRFTHEEFSSAEDAQCSICLGEYQEKEVL
RIMPGCGHNFHLSCIDVWLRKQSTCPVCRFPIQDSFEAKHMRQTAISMVQSIDSPDTRSEQSRQWLLPSYQGSAGNHSNQRHLDPVPGNPEITPGESQTS
RS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G20030 RING/U-box superfamily protein... Potri.002G153400 0 1
AT2G32800 AP4.3A protein kinase family protein ... Potri.017G055000 5.38 0.8017
AT1G55760 BTB/POZ domain-containing prot... Potri.001G468700 7.93 0.7909
AT1G66920 Protein kinase superfamily pro... Potri.010G118300 8.12 0.7529
AT5G48930 HCT hydroxycinnamoyl-CoA shikimate... Potri.003G183900 9.16 0.7948
AT1G08320 bZIP TGA9, bZIP21 TGACG \(TGA\) motif-binding pr... Potri.004G203400 10.09 0.7889
AT5G15900 TBL19 TRICHOME BIREFRINGENCE-LIKE 19... Potri.004G105700 10.77 0.7909
AT4G12350 MYB ATMYB42 myb domain protein 42 (.1) Potri.001G118800 12.24 0.7904
AT4G02020 SDG10, SWINGER,... SWINGER, SET DOMAIN-CONTAINING... Potri.014G120100 12.24 0.7437 SDG913,EMB173.1
AT1G54710 ATATG18H homolog of yeast autophagy 18 ... Potri.013G028200 16.88 0.7346
AT2G16980 Major facilitator superfamily ... Potri.002G016200 19.18 0.7772

Potri.002G153400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.