Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61260 167 / 1e-52 Remorin family protein (.1) AT2G45820 148 / 3e-45 Remorin family protein (.1) AT5G23750 145 / 5e-44 Remorin family protein (.1.2) AT3G48940 138 / 2e-41 Remorin family protein (.1) AT1G63295 72 / 4e-16 Remorin family protein (.1) AT4G00670 69 / 5e-15 Remorin family protein (.1) AT3G57540 46 / 5e-06 Remorin family protein (.1) AT2G02170 45 / 9e-06 Remorin family protein (.1.2) AT1G30320 45 / 1e-05 Remorin family protein (.1) AT2G41870 44 / 2e-05 Remorin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G081300 [exp] 226 / 6e-76 AT3G61260 199 / 4e-65 Remorin family protein (.1) Potri.015G143600 [exp] 143 / 4e-43 AT5G23750 111 / 1e-30 Remorin family protein (.1.2) Potri.003G124400 [exp] 135 / 2e-40 AT5G23750 129 / 6e-38 Remorin family protein (.1.2) Potri.012G140800 [exp] 124 / 1e-35 AT5G23750 98 / 2e-25 Remorin family protein (.1.2) Potri.001G107000 [exp] 103 / 2e-27 AT5G23750 55 / 2e-09 Remorin family protein (.1.2) Potri.012G140900 [exp] 57 / 1e-10 AT3G48940 78 / 6e-19 Remorin family protein (.1) Potri.006G053200 [exp] 50 / 2e-07 AT3G57540 196 / 2e-61 Remorin family protein (.1) Potri.014G027900 [exp] 48 / 2e-06 AT1G45207 442 / 1e-149 Remorin family protein (.2) Potri.016G054400 [exp] 47 / 3e-06 AT2G41870 206 / 7e-66 Remorin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018840 [exp] 178 / 1e-56 AT3G61260 206 / 1e-67 Remorin family protein (.1) Lus10017811 [exp] 166 / 4e-52 AT3G61260 199 / 5e-65 Remorin family protein (.1) Lus10027460 [exp] 152 / 8e-47 AT3G61260 192 / 2e-62 Remorin family protein (.1) Lus10014785 [exp] 151 / 2e-46 AT3G61260 177 / 1e-56 Remorin family protein (.1) Lus10039215 [exp] 150 / 5e-46 AT3G61260 196 / 7e-64 Remorin family protein (.1) Lus10030379 [exp] 136 / 1e-40 AT3G61260 178 / 4e-57 Remorin family protein (.1) Lus10001477 [exp] 109 / 8e-30 AT5G23750 162 / 3e-50 Remorin family protein (.1.2) Lus10008014 [exp] 103 / 1e-28 AT5G23750 158 / 5e-50 Remorin family protein (.1.2) Lus10008477 [exp] 105 / 5e-28 AT5G23750 154 / 5e-47 Remorin family protein (.1.2) Lus10024514 [exp] 63 / 2e-12 AT5G23750 113 / 5e-32 Remorin family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03763 [poplar] [flax] Remorin_C Remorin, C-terminal region PF03766 [poplar] [flax] Remorin_N Remorin, N-terminal region
Representative CDS sequence Show only first row Show all	>Potri.002G157700.2 pacid=42779733 polypeptide=Potri.002G157700.2.p locus=Potri.002G157700 ID=Potri.002G157700.2.v4.1 annot-version=v4.1 ATGGCAGAGCAGGAGGTGAAGAAGGTAGAGGCTGTAACGCCCGTGGCTCCAGCTCCAGTGGAAACTAAAAGTGATGTGGCCGATGGGAAAGTTACGGCTC CACCACCTCCAGTGGCTGCAGAGAAACAGAAGGCAGCTACTGCTGCTGAGGAATCAAAAGCTCTTGCTGTTGTTGAAAAGACAGAACCTGCTCCGAAGAA GGTTTCAGGCGGATCAATTGACAGAGATGTAGCTCTTGCTGACCTTGAAAAAGAAAAGAGACTTTCCTTTATCAAGGCATGGGAAGACAGCGAGAAAACT AAAGCCGAGAACAAGTCTCAGAAAAATTTCTCTGCTGTTGCTGCCTGGGAGAACAGCAAAAAGGCAGCTCTGGAAGCCAAACTGAGAAAGATGGAGGAAA AACTGGAGAAGCAAAAGGCAGAATATGCAGAGAAAATGAAAAACAAGATTGCTTTAATTCACAAAGAAGCTGAGGAAAAGAAGGCAATTGTTGAAGCCAA ACGCGGGGAAGAGGTCTTAAAGGCAGGGGAGACGGCTGCAAAATACCGTGCTACTGGGCAAACCCCAAAGAAGCTCCTTGGTTGCTTCTGA
AA sequence Show only first row Show all	>Potri.002G157700.2 pacid=42779733 polypeptide=Potri.002G157700.2.p locus=Potri.002G157700 ID=Potri.002G157700.2.v4.1 annot-version=v4.1 MAEQEVKKVEAVTPVAPAPVETKSDVADGKVTAPPPPVAAEKQKAATAAEESKALAVVEKTEPAPKKVSGGSIDRDVALADLEKEKRLSFIKAWEDSEKT KAENKSQKNFSAVAAWENSKKAALEAKLRKMEEKLEKQKAEYAEKMKNKIALIHKEAEEKKAIVEAKRGEEVLKAGETAAKYRATGQTPKKLLGCF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61260			Remorin family protein (.1)		Potri.002G157700 [exp]	0	1
AT3G19970			alpha/beta-Hydrolases superfam...		Potri.005G089000 [exp]	3.46	0.7221
AT1G71970			unknown protein		Potri.019G082866 [exp]	10.14	0.7739
AT1G69640		SBH1	sphingoid base hydroxylase 1 (...		Potri.005G200000 [exp]	16.70	0.7426
AT2G33510		AtCFL1	unknown protein		Potri.001G062000 [exp]	17.83	0.6546
AT5G67490			unknown protein		Potri.015G017700 [exp]	21.16	0.7069
AT4G35160			O-methyltransferase family pro...		Potri.013G121300 [exp]	22.24	0.7068	OOMT2.16
AT4G23630		RTNLB1, BTI1	Reticulan like protein B1, VIR...		Potri.001G097700 [exp]	23.62	0.7085
AT5G15470		GAUT14	galacturonosyltransferase 14 (...		Potri.017G090800 [exp]	30.93	0.6400
AT1G06760			winged-helix DNA-binding trans...		Potri.010G076800 [exp]	44.02	0.6275
AT5G46230			Protein of unknown function, D...		Potri.004G064700 [exp]	46.45	0.6409

Compare expression of checked genes

Potri.002G157700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.