Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18970 58 / 1e-11 MEF20 mitochondrial editing factor 20 (.1) AT5G56310 52 / 3e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G28690 51 / 5e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G32415 51 / 5e-09 pentatricopeptide (PPR) repeat-containing protein (.1) AT3G49710 50 / 8e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G11460 50 / 8e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G59600 50 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G33990 50 / 2e-08 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G19191 49 / 3e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G02330 49 / 3e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G217900 [exp] 54 / 3e-10 AT2G22410 530 / 0.0 SLOW GROWTH 1 (.1) Potri.012G140400 [exp] 54 / 3e-10 AT3G29230 398 / 2e-132 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G252400 [exp] 54 / 4e-10 AT4G21065 496 / 8e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.015G018700 [exp] 53 / 7e-10 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.017G087600 [exp] 53 / 9e-10 AT5G15340 754 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G048800 [exp] 52 / 2e-09 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G054000 [exp] 52 / 2e-09 AT1G28690 672 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G211400 [exp] 51 / 6e-09 AT3G11460 772 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G220300 [exp] 50 / 7e-09 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004253 [exp] 60 / 3e-12 AT3G49170 832 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10042161 [exp] 57 / 3e-11 AT3G49170 484 / 1e-163 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10035815 [exp] 56 / 8e-11 AT4G30700 1026 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002024 [exp] 53 / 8e-10 AT5G56310 344 / 6e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10036596 [exp] 53 / 1e-09 AT4G30700 445 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030418 [exp] 50 / 1e-08 AT2G03380 666 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014950 [exp] 50 / 1e-08 AT5G52850 683 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014653 [exp] 50 / 2e-08 AT5G15340 634 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10033775 [exp] 50 / 2e-08 AT5G15340 635 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10025009 [exp] 49 / 2e-08 AT1G15510 1020 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G159600.1 pacid=42777765 polypeptide=Potri.002G159600.1.p locus=Potri.002G159600 ID=Potri.002G159600.1.v4.1 annot-version=v4.1 ATGTTGGATTGTGGGGTAAAGCTCAATGATGATGTTTCTCTCTCTTTTCAATCTGCCCTTCGTCCATGTGGGCTAGAATGTAAGGGTCATGACTTGTTTA TTTCATTTAAGAAAAAGTATGGTCGTACTCCAAAACTTGCACATTATGCTTGCATGGTGGATCTGCTAATTTGGCAAGGAAAGGTTGAGGAAGCTCTTGA ATTTGAAACAAAATGCCATTGGAGCCTTTAA
AA sequence Show only first row Show all	>Potri.002G159600.1 pacid=42777765 polypeptide=Potri.002G159600.1.p locus=Potri.002G159600 ID=Potri.002G159600.1.v4.1 annot-version=v4.1 MLDCGVKLNDDVSLSFQSALRPCGLECKGHDLFISFKKKYGRTPKLAHYACMVDLLIWQGKVEEALEFETKCHWSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G18970		MEF20	mitochondrial editing factor ...		Potri.002G159600 [exp]	0	1
AT3G11110			RING/U-box superfamily protein...		Potri.008G071000 [exp]	8.77	0.8420
AT5G06540			Pentatricopeptide repeat (PPR)...		Potri.016G065500 [exp]	16.73	0.8321
AT1G69350			Tetratricopeptide repeat (TPR)...		Potri.008G093000 [exp]	19.13	0.8298
AT5G08310			Tetratricopeptide repeat (TPR)...		Potri.005G090600 [exp]	27.27	0.8196
					Potri.019G045466 [exp]	27.27	0.8013
AT1G48570			zinc finger (Ran-binding) fami...		Potri.015G038200 [exp]	29.06	0.8226
AT5G06400			Pentatricopeptide repeat (PPR)...		Potri.006G200800 [exp]	29.32	0.8252
AT3G56550			Pentatricopeptide repeat (PPR)...		Potri.016G029500 [exp]	30.57	0.8118
AT5G08305			Pentatricopeptide repeat (PPR)...		Potri.007G073100 [exp]	30.85	0.8191
AT3G48250		BIR6	Buthionine sulfoximine-insensi...		Potri.015G084800 [exp]	32.03	0.8053

Compare expression of checked genes

Potri.002G159600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.