Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-UBC4.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63800 287 / 2e-100 UBC5 ubiquitin-conjugating enzyme 5 (.1) AT5G41340 287 / 2e-100 ATUBC4, UBC4 ubiquitin conjugating enzyme 4 (.1) AT2G46030 266 / 5e-92 UBC6 ubiquitin-conjugating enzyme 6 (.1) AT3G08690 99 / 2e-26 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G53300 98 / 3e-26 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT3G08700 97 / 6e-26 UBC12 ubiquitin-conjugating enzyme 12 (.1) AT1G64230 97 / 6e-26 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT2G16740 97 / 8e-26 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 97 / 8e-26 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT4G27960 97 / 9e-26 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G086600 [exp] 326 / 1e-115 AT1G63800 283 / 8e-99 ubiquitin-conjugating enzyme 5 (.1) Potri.001G101900 [exp] 307 / 3e-108 AT5G41340 292 / 3e-102 ubiquitin conjugating enzyme 4 (.1) Potri.003G129700 [exp] 297 / 2e-104 AT5G41340 284 / 5e-99 ubiquitin conjugating enzyme 4 (.1) Potri.015G073400 [exp] 264 / 2e-91 AT5G41340 268 / 1e-92 ubiquitin conjugating enzyme 4 (.1) Potri.004G175000 [exp] 97 / 8e-26 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.011G168200 [exp] 96 / 1e-25 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.012G104100 [exp] 97 / 2e-25 AT5G50870 334 / 1e-118 ubiquitin-conjugating enzyme 27 (.1.2) Potri.013G064400 [exp] 96 / 2e-25 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.003G136200 [exp] 96 / 3e-25 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014763 [exp] 305 / 3e-107 AT1G63800 294 / 6e-103 ubiquitin-conjugating enzyme 5 (.1) Lus10036372 [exp] 293 / 2e-102 AT1G63800 286 / 9e-100 ubiquitin-conjugating enzyme 5 (.1) Lus10002359 [exp] 274 / 1e-94 AT1G63800 275 / 5e-95 ubiquitin-conjugating enzyme 5 (.1) Lus10032274 [exp] 267 / 1e-92 AT1G63800 278 / 5e-97 ubiquitin-conjugating enzyme 5 (.1) Lus10042136 [exp] 253 / 1e-86 AT1G63800 267 / 2e-92 ubiquitin-conjugating enzyme 5 (.1) Lus10024638 [exp] 224 / 2e-75 AT1G63800 229 / 2e-77 ubiquitin-conjugating enzyme 5 (.1) Lus10021385 [exp] 97 / 1e-25 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027846 [exp] 97 / 1e-25 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 97 / 1e-25 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 97 / 1e-25 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.002G161000.1 pacid=42778329 polypeptide=Potri.002G161000.1.p locus=Potri.002G161000 ID=Potri.002G161000.1.v4.1 annot-version=v4.1 ATGTCTTCCCCGAGCAAACGCAGAGAGATGGACTTGATGAAATTGATGATGAGTGATTACAAGGTGGAGTTGATCAATGACGGTATGCAAGAGTTTTATG TTCATTTCAATGGACCCAATGAAAGTCCTTATCATGGAGGTGTGTGGAGAATAAGAGTTGAGCTACCCGATGCTTATCCTTATAAATCTCCCTCAATAGG TTTTGTTAATAAGATCTACCATCCAAATGTTGATGAAATGTCTGGCTCGGTTTGTTTAGACGTTATTAATCAAACTTGGAGCCCCATGTTTGATTTGGTA AATGTGTTTGAAGTATTTCTTCCACAGCTTCTTCTGTATCCTAACCCATCAGACCCATTGAATGGTGAGGCTGCAGCTCTGATGATGCGTGACAAGCCTG CTTATGAGCAAAGAGTTGAAGAATACTGTGAGAAATATGCCAAGCCAGAGGACATTGGAGCTGCCCCAGAAGAAAAATCAAGTGACGAGGAGTTGAGTGA AGATGAGTACGAGTCTCTTGATGATGAAATGGCAGGCCAAGCAGATCCATAG
AA sequence Show only first row Show all	>Potri.002G161000.1 pacid=42778329 polypeptide=Potri.002G161000.1.p locus=Potri.002G161000 ID=Potri.002G161000.1.v4.1 annot-version=v4.1 MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLV NVFEVFLPQLLLYPNPSDPLNGEAAALMMRDKPAYEQRVEEYCEKYAKPEDIGAAPEEKSSDEELSEDEYESLDDEMAGQADP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Potri.002G161000 [exp]	0	1	Pt-UBC4.1
					Potri.008G164250 [exp]	1.73	0.8594
AT1G73830	bHLH	bHLH050, BEE3	BR enhanced expression 3 (.1.2...		Potri.012G055700 [exp]	6.00	0.7950
AT1G77670			Pyridoxal phosphate (PLP)-depe...		Potri.002G086000 [exp]	7.74	0.7187
					Potri.006G037801 [exp]	10.58	0.7845
AT5G53980	HD	ATHB52	homeobox protein 52 (.1)		Potri.007G135100 [exp]	10.95	0.7720
AT5G24580			Heavy metal transport/detoxifi...		Potri.015G003900 [exp]	15.29	0.7380
AT2G39980			HXXXD-type acyl-transferase fa...		Potri.010G192400 [exp]	16.97	0.6771
AT1G07710			Ankyrin repeat family protein ...		Potri.005G069400 [exp]	18.97	0.7375
AT5G66390			Peroxidase superfamily protein...		Potri.005G118700 [exp]	19.07	0.7230
AT1G78860			D-mannose binding lectin prote...		Potri.001G391200 [exp]	21.54	0.7114

Compare expression of checked genes

Potri.002G161000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.