Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-BRH1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61460 233 / 1e-79 BRH1 brassinosteroid-responsive RING-H2 (.1) AT1G63840 172 / 2e-55 RING/U-box superfamily protein (.1) AT5G41400 142 / 2e-43 RING/U-box superfamily protein (.1) AT4G11360 114 / 1e-32 RHA1B RING-H2 finger A1B (.1) AT4G11370 107 / 5e-30 RHA1A RING-H2 finger A1A (.1) AT4G00305 87 / 2e-22 RING/U-box superfamily protein (.1) AT3G43430 73 / 1e-16 RING/U-box superfamily protein (.1) AT5G20885 69 / 7e-15 RING/U-box superfamily protein (.1) AT2G04240 66 / 7e-14 XERICO RING/U-box superfamily protein (.1.2) AT5G41440 60 / 6e-12 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G087700 [exp] 293 / 2e-103 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1) Potri.003G130900 [exp] 180 / 1e-58 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1) Potri.001G101000 [exp] 161 / 4e-51 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1) Potri.006G217000 [exp] 79 / 7e-19 AT5G20885 138 / 8e-42 RING/U-box superfamily protein (.1) Potri.010G047100 [exp] 69 / 1e-15 AT1G67856 133 / 4e-41 RING/U-box superfamily protein (.1) Potri.007G086300 [exp] 69 / 4e-15 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1) Potri.001G450700 [exp] 68 / 9e-15 AT3G61460 71 / 2e-15 brassinosteroid-responsive RING-H2 (.1) Potri.014G170400 [exp] 67 / 2e-14 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2) Potri.011G150800 [exp] 66 / 5e-14 AT3G61460 69 / 1e-14 brassinosteroid-responsive RING-H2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036378 [exp] 209 / 1e-69 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1) Lus10032290 [exp] 187 / 3e-61 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1) Lus10024657 [exp] 177 / 2e-57 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1) Lus10017510 [exp] 157 / 2e-49 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1) Lus10028773 [exp] 150 / 7e-47 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1) Lus10014758 [exp] 75 / 3e-18 AT3G61460 71 / 7e-17 brassinosteroid-responsive RING-H2 (.1) Lus10008283 [exp] 77 / 8e-18 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1) Lus10019973 [exp] 68 / 8e-14 AT4G30400 252 / 4e-80 RING/U-box superfamily protein (.1) Lus10011702 [exp] 65 / 1e-12 AT4G28890 231 / 1e-71 RING/U-box superfamily protein (.1) Lus10015502 [exp] 64 / 2e-12 AT4G30400 251 / 1e-79 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.002G161900.1 pacid=42779343 polypeptide=Potri.002G161900.1.p locus=Potri.002G161900 ID=Potri.002G161900.1.v4.1 annot-version=v4.1 ATGGGGTTTCCAGTTGGGTATTCAGAGGTTTTCTTACCAAAGTTGTTTGTACACATACTTTCCTTTCTGGGTTTTATCAGAAACCTCATTCTGTGTCTTT TCAACTATCTGGGGTTGTCAGGTTTTCTTGAAACAGACAATATTTGGCCCGACAACCCGATCCGAATGTCCTGCTACCCGCCTCTATCAGCTGCCCTTCT CCGGGAAATCTTGCCTGTCATCAAGTTCGAGGATTTGGTTACTGGGGATGGTGGTTGTTGTGACTTGCCGGAGAGTTGTGCTGTTTGTTTGTATGAGTTT GAGGGAGAGGATGAGATCAGGTGGTTGAAGAATTGTAAGCACATTTTTCACAGGACTTGTTTGGACCGTTGGATGGATCATGATAGGAAAACGTGTCCAC TTTGCAGGAACTCGTTTGTGCCTGATGAGATGCAGGAAGAGTTTAATCAACGGTTATGGGCTGCAAATAATGATGTTAGTGATTTTTACTGTGAGTAG
AA sequence Show only first row Show all	>Potri.002G161900.1 pacid=42779343 polypeptide=Potri.002G161900.1.p locus=Potri.002G161900 ID=Potri.002G161900.1.v4.1 annot-version=v4.1 MGFPVGYSEVFLPKLFVHILSFLGFIRNLILCLFNYLGLSGFLETDNIWPDNPIRMSCYPPLSAALLREILPVIKFEDLVTGDGGCCDLPESCAVCLYEF EGEDEIRWLKNCKHIFHRTCLDRWMDHDRKTCPLCRNSFVPDEMQEEFNQRLWAANNDVSDFYCE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61460		BRH1	brassinosteroid-responsive RIN...		Potri.002G161900 [exp]	0	1	Pt-BRH1.2
AT3G03280			unknown protein		Potri.006G105500 [exp]	4.00	0.8882
AT4G34410	AP2_ERF	RRTF1 (Redox Re...	redox responsive transcription...		Potri.009G101900 [exp]	4.69	0.8920
AT3G03280			unknown protein		Potri.006G105600 [exp]	5.65	0.8732
AT2G45760		BAL, BAP2	BON ASSOCIATION PROTEIN 1-LIKE...		Potri.014G078700 [exp]	7.93	0.8394	BAP2.2
					Potri.016G004500 [exp]	8.66	0.8753
AT1G19210	AP2_ERF		Integrase-type DNA-binding sup...		Potri.006G138700 [exp]	12.64	0.8396
AT1G19210	AP2_ERF		Integrase-type DNA-binding sup...		Potri.006G218200 [exp]	15.19	0.7885
AT4G17490	AP2_ERF	ERF-6-6, ATERF6	ethylene responsive element bi...		Potri.001G154200 [exp]	16.52	0.8103	Pt-ERF5.2,ERF4
AT5G22250		AtCAF1b	CCR4- associated factor 1b, Po...		Potri.004G200400 [exp]	17.14	0.8595
AT5G51990	AP2_ERF	CBF4, DREB1D	DEHYDRATION-RESPONSIVE ELEMENT...		Potri.001G110700 [exp]	17.54	0.7955	DREB69,Pt-DREB1.6

Compare expression of checked genes

Potri.002G161900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.