Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61520 69 / 3e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G28370 67 / 8e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G28460 67 / 8e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63630 57 / 9e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G12775 59 / 1e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G16640 58 / 2e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62720 58 / 2e-11 AtNG1 novel gene 1, Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G39710 57 / 4e-11 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G79540 57 / 5e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62910 57 / 5e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G090400 [exp] 132 / 1e-37 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G271400 [exp] 66 / 5e-14 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G271200 [exp] 63 / 3e-13 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.015G105400 [exp] 63 / 4e-13 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G074500 [exp] 63 / 4e-13 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.019G021200 [exp] 61 / 1e-12 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G242500 [exp] 60 / 3e-12 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G141800 [exp] 60 / 3e-12 AT2G06000 588 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Potri.004G074700 [exp] 60 / 4e-12 AT1G62930 481 / 1e-164 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040633 [exp] 92 / 2e-23 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10008593 [exp] 64 / 2e-13 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10004615 [exp] 62 / 1e-12 AT2G06000 531 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Lus10003433 [exp] 61 / 2e-12 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003427 [exp] 60 / 4e-12 AT1G12700 291 / 8e-92 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003447 [exp] 59 / 1e-11 AT1G12700 202 / 1e-56 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10038804 [exp] 59 / 1e-11 AT5G64320 367 / 3e-115 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014245 [exp] 59 / 1e-11 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014244 [exp] 59 / 1e-11 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10009023 [exp] 59 / 2e-11 AT3G48810 543 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.002G164501.1 pacid=42779369 polypeptide=Potri.002G164501.1.p locus=Potri.002G164501 ID=Potri.002G164501.1.v4.1 annot-version=v4.1 ATGAGTGGAGGTAAAGAGAGTGGTGGCTTAAGCGTTTCAGTTGAACCAGTTGTTGTTATTTACAATACCCTGATTGATGGACTTTGTAAAGTTGGAAGGC AAGCAGAGGGATTGGGTTTGATGGAACGAACGAGATTGCAAAAGGGGTGTTCTCCTGATACAATTACGTACAATTGCTTGATCAATGGGCTTTGTAAAGC GGGTGAGGAACAAAAGGAAAGGAGCTGTTTTATGAGATGA
AA sequence Show only first row Show all	>Potri.002G164501.1 pacid=42779369 polypeptide=Potri.002G164501.1.p locus=Potri.002G164501 ID=Potri.002G164501.1.v4.1 annot-version=v4.1 MSGGKESGGLSVSVEPVVVIYNTLIDGLCKVGRQAEGLGLMERTRLQKGCSPDTITYNCLINGLCKAGEEQKERSCFMR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G28370			Pentatricopeptide repeat (PPR)...		Potri.002G164501 [exp]	0	1

Compare expression of checked genes

Potri.002G164501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.