Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46150 184 / 1e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G64065 83 / 2e-19 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G54200 74 / 7e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G23610 61 / 4e-11 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G52330 59 / 9e-11 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) AT3G05975 59 / 1e-10 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G23930 49 / 3e-07 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G133400 [exp] 155 / 2e-47 AT2G46150 164 / 7e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.001G098100 [exp] 154 / 6e-47 AT2G46150 171 / 2e-53 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.001G098200 [exp] 106 / 7e-29 AT1G64065 102 / 2e-27 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.014G090900 [exp] 103 / 1e-28 AT2G46150 64 / 7e-14 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G142300 [exp] 86 / 9e-21 AT3G54200 162 / 3e-50 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G112800 [exp] 79 / 5e-18 AT3G54200 159 / 7e-49 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G230400 [exp] 77 / 1e-17 AT2G46150 82 / 3e-19 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G025100 [exp] 65 / 1e-12 AT2G46150 77 / 3e-17 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G112700 [exp] 63 / 5e-12 AT3G05975 127 / 6e-37 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007904 [exp] 139 / 4e-41 AT2G46150 159 / 1e-48 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10036403 [exp] 125 / 1e-35 AT2G46150 156 / 8e-48 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10017531 [exp] 100 / 9e-26 AT2G46150 98 / 5e-25 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018361 [exp] 83 / 2e-19 AT3G54200 91 / 1e-22 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006764 [exp] 79 / 6e-18 AT3G54200 79 / 5e-18 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10043084 [exp] 79 / 7e-18 AT3G54200 141 / 2e-41 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007649 [exp] 78 / 1e-17 AT3G54200 85 / 2e-20 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10032671 [exp] 77 / 4e-17 AT3G54200 141 / 1e-41 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018185 [exp] 74 / 5e-16 AT3G54200 153 / 9e-47 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10025649 [exp] 73 / 1e-15 AT3G54200 152 / 2e-46 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.002G165100.1 pacid=42778359 polypeptide=Potri.002G165100.1.p locus=Potri.002G165100 ID=Potri.002G165100.1.v4.1 annot-version=v4.1 ATGGCGAAACGCGAGCAGGTAAGACCACTGGCCCCGGCTGCGGAGCGCCGATGCAGCGACGAAGAAGGGGCTTCTAAACACCATAAGAAACGAAGCAGAA AATGCGTCAAATGCTGTGTATTCGTCACAGCCATATTTGTCATTCTAGTCACAGCGATCATAGTTTTACGTTTCACTGTCTTTCGTGTCAAAGACCCTGT CATCACAATGAACAGTTTCACGATCACTAAGTTGGAGCTAAGCAATGGCACAACTCCCAAGCCAGGGGTGAACATAACCCTAATTGCAGATGTATCAGTT AAAAATCCCAACGTAGCATCATTCAAGTATAGCAACACCACCACAACCCTCTACTACGACAGGCAGATAGTTGGGGAGGCCAGAAACGGACCGGGCCATG CTAGGGCCAGACGGACCATGAGGATGAATGTTACTGTGGATATCATCCCAGACAGGATCATGTCAAACCCAAATCTGAATGCTGATATGAGCTCTGGGAT ATTGTCCATGACCACCTACACAAGAGTTCCAGGGAGGATGAAAATAGTGATTGTCAAGAGGAATATTGTTGTGAAAATGACCTGCAGCATAACACTTAAT ATTACGAGCCAGCAAATTCAGACACAGAAGTGCAAGCGGAAAGTTGATTTTTAG
AA sequence Show only first row Show all	>Potri.002G165100.1 pacid=42778359 polypeptide=Potri.002G165100.1.p locus=Potri.002G165100 ID=Potri.002G165100.1.v4.1 annot-version=v4.1 MAKREQVRPLAPAAERRCSDEEGASKHHKKRSRKCVKCCVFVTAIFVILVTAIIVLRFTVFRVKDPVITMNSFTITKLELSNGTTPKPGVNITLIADVSV KNPNVASFKYSNTTTTLYYDRQIVGEARNGPGHARARRTMRMNVTVDIIPDRIMSNPNLNADMSSGILSMTTYTRVPGRMKIVIVKRNIVVKMTCSITLN ITSQQIQTQKCKRKVDF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46150			Late embryogenesis abundant (L...		Potri.002G165100 [exp]	0	1
AT5G02070			Protein kinase family protein ...		Potri.005G021300 [exp]	1.00	0.9729
AT3G24310	MYB	MYB305, ATMYB71	MYB DOMAIN PROTEIN 71, myb dom...		Potri.008G173400 [exp]	1.41	0.9709	Pt-MYB305.1
AT2G24130			Leucine-rich receptor-like pro...		Potri.006G181200 [exp]	2.44	0.9683
AT3G30210	MYB	ATMYB121	myb domain protein 121 (.1)		Potri.017G099500 [exp]	3.46	0.9496
AT3G22060			Receptor-like protein kinase-r...		Potri.017G040132 [exp]	4.24	0.9350
AT2G47810	CCAAT	NF-YB5	"nuclear factor Y, subunit B5"...		Potri.014G132600 [exp]	5.29	0.9331
AT1G05450			Bifunctional inhibitor/lipid-t...		Potri.010G085200 [exp]	5.47	0.9372
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.010G075600 [exp]	7.07	0.9169
AT3G22600			Bifunctional inhibitor/lipid-t...		Potri.010G085400 [exp]	9.38	0.9257
AT1G16310			Cation efflux family protein (...		Potri.010G172800 [exp]	9.38	0.8859

Compare expression of checked genes

Potri.002G165100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.