Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41761 86 / 2e-23 unknown protein AT3G55570 80 / 3e-21 unknown protein AT3G09950 65 / 2e-15 unknown protein AT3G11405 61 / 5e-13 unknown protein AT5G55620 54 / 4e-11 unknown protein AT5G06010 47 / 2e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G095100 [exp] 146 / 5e-48 AT5G41761 92 / 3e-26 unknown protein Potri.014G095000 [exp] 125 / 3e-39 AT5G41761 97 / 1e-27 unknown protein Potri.012G031900 [exp] 100 / 3e-29 AT5G41761 88 / 2e-24 unknown protein Potri.003G136700 [exp] 99 / 1e-28 AT5G41761 102 / 4e-30 unknown protein Potri.001G313700 [exp] 84 / 3e-23 AT3G55570 93 / 2e-26 unknown protein Potri.006G017700 [exp] 83 / 2e-22 AT5G41761 83 / 6e-22 unknown protein Potri.001G313801 [exp] 69 / 7e-17 AT3G55570 85 / 1e-22 unknown protein Potri.001G364550 [exp] 35 / 0.001 AT5G41761 39 / 5e-05 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012634 [exp] 97 / 5e-28 AT5G41761 85 / 6e-23 unknown protein Lus10000541 [exp] 88 / 2e-24 AT5G41761 96 / 2e-27 unknown protein Lus10017552 [exp] 86 / 4e-23 AT5G41761 94 / 2e-25 unknown protein Lus10038794 [exp] 71 / 1e-17 AT3G09950 82 / 6e-22 unknown protein Lus10039065 [exp] 69 / 6e-17 AT3G09950 85 / 6e-23 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G167900.1 pacid=42778880 polypeptide=Potri.002G167900.1.p locus=Potri.002G167900 ID=Potri.002G167900.1.v4.1 annot-version=v4.1 ATGGAGTCGGTAGTCAGGCCACCTTCAAACATAGGCAGTGGACCAAGTGGGCAGCACACAAAGGAGCGGTGTGGGGACTTTCAGATGCCATTGCACTACC CAAGATACACCCTAGCCGAATATCAGACCATGCCGGAGTGGAAACTTGATTGCCTGCTTAAAGAGTATGGGTTGCCAATCACCGGAGATGTTGAACAGAA GAGGAACTTCGCCATGGGAGCTTTTCTTTGGCTCCATTAG
AA sequence Show only first row Show all	>Potri.002G167900.1 pacid=42778880 polypeptide=Potri.002G167900.1.p locus=Potri.002G167900 ID=Potri.002G167900.1.v4.1 annot-version=v4.1 MESVVRPPSNIGSGPSGQHTKERCGDFQMPLHYPRYTLAEYQTMPEWKLDCLLKEYGLPITGDVEQKRNFAMGAFLWLH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G41761			unknown protein		Potri.002G167900 [exp]	0	1
AT1G15460		ATBOR4	ARABIDOPSIS THALIANA REQUIRES ...		Potri.001G174500 [exp]	1.41	0.8880
AT4G22290			Ubiquitin-specific protease fa...		Potri.002G176200 [exp]	2.44	0.8860
AT4G16130		ATISA1, ARA1	arabinose kinase (.1)		Potri.018G138202 [exp]	2.44	0.8863
AT2G47480			Protein of unknown function (D...		Potri.010G140800 [exp]	3.46	0.8843
AT4G30420			nodulin MtN21 /EamA-like trans...		Potri.006G177700 [exp]	4.47	0.8838
AT4G21020			Late embryogenesis abundant pr...		Potri.004G046000 [exp]	4.58	0.7838	Pt-PM32.1
AT4G16130		ATISA1, ARA1	arabinose kinase (.1)		Potri.018G145700 [exp]	4.89	0.8756	Pt-ARA1.1
AT2G31090			unknown protein		Potri.019G090500 [exp]	5.09	0.8215
AT3G07960		PIP5K6	phosphatidylinositol-4-phospha...		Potri.003G196000 [exp]	5.29	0.8212
AT1G28270		RALFL4	ralf-like 4 (.1)		Potri.004G045000 [exp]	5.65	0.8684

Compare expression of checked genes

Potri.002G167900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.