Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64585 44 / 3e-08 RTFL22, DVL12 DEVIL 12, ROTUNDIFOLIA like 22 (.1) AT3G55515 40 / 2e-06 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT2G29125 40 / 4e-06 RTFL2, DVL13 DEVIL 13, ROTUNDIFOLIA like 2 (.1) AT1G67265 39 / 4e-06 DVL3, RTFL21 DEVIL 3, ROTUNDIFOLIA like 21 (.1) AT3G14362 38 / 1e-05 DVL19, RTFL10 DEVIL 19, ROTUNDIFOLIA like 10 (.1) AT3G46613 39 / 2e-05 RTFL4, DVL15 DEVIL 15, ROTUNDIFOLIA like 4 (.1) AT2G39705 38 / 2e-05 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1) AT4G13395 37 / 2e-05 DVL10, RTFL12 DEVIL 10, ROTUNDIFOLIA like 12 (.1) AT5G59510 38 / 3e-05 RTFL5, DVL18 DEVIL 18, ROTUNDIFOLIA like 5 (.1) AT1G13245 36 / 4e-05 RTFL17, DVL4 DEVIL 4, ROTUNDIFOLIA like 17 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G087150 [exp] 53 / 1e-11 AT1G64585 48 / 2e-09 DEVIL 12, ROTUNDIFOLIA like 22 (.1) Potri.010G201700 [exp] 42 / 3e-07 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.008G057800 [exp] 42 / 5e-07 AT2G39705 84 / 8e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.008G035900 [exp] 40 / 2e-06 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.001G242800 [exp] 40 / 2e-06 AT2G29125 71 / 4e-17 DEVIL 13, ROTUNDIFOLIA like 2 (.1) Potri.009G034300 [exp] 40 / 5e-06 AT2G29125 64 / 9e-15 DEVIL 13, ROTUNDIFOLIA like 2 (.1) Potri.010G226250 [exp] 39 / 5e-06 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G129600 [exp] 39 / 6e-06 AT1G13245 75 / 1e-20 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.017G112100 [exp] 38 / 7e-06 AT1G67265 62 / 1e-15 DEVIL 3, ROTUNDIFOLIA like 21 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002705 [exp] 42 / 5e-07 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10023399 [exp] 42 / 1e-06 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10001569 [exp] 39 / 1e-05 AT5G59510 79 / 8e-20 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10040784 [exp] 39 / 2e-05 AT5G59510 84 / 1e-21 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10034272 [exp] 38 / 2e-05 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10041491 [exp] 37 / 3e-05 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10021966 [exp] 34 / 0.0006 AT1G53708 73 / 8e-19 ROTUNDIFOLIA like 9 (.1) Lus10034071 [exp] 34 / 0.0007 AT5G16023 56 / 2e-12 DEVIL 1, ROTUNDIFOLIA like 18 (.1) Lus10041846 [exp] 34 / 0.0008 AT4G35783 59 / 1e-13 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10003079 [exp] 34 / 0.0009 AT5G16023 55 / 3e-12 DEVIL 1, ROTUNDIFOLIA like 18 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [poplar] [flax] DVL DVL family
Representative CDS sequence Show only first row Show all	>Potri.002G173750.1 pacid=42777388 polypeptide=Potri.002G173750.1.p locus=Potri.002G173750 ID=Potri.002G173750.1.v4.1 annot-version=v4.1 ATGGGCAAAGCATGTCTAGCTTTTTCACTTAGAAGACGAGGCAAAGTTCAGGTTCCAAGCAAGAGCCTGAAAGGGAAGAGAGGAAGACTATATATTATCA TGCGCTGTGTGTTGATGCTGGTTTGCTGGAGGGACCATGGAGATAAGTGA
AA sequence Show only first row Show all	>Potri.002G173750.1 pacid=42777388 polypeptide=Potri.002G173750.1.p locus=Potri.002G173750 ID=Potri.002G173750.1.v4.1 annot-version=v4.1 MGKACLAFSLRRRGKVQVPSKSLKGKRGRLYIIMRCVLMLVCWRDHGDK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G64585		RTFL22, DVL12	DEVIL 12, ROTUNDIFOLIA like 22...		Potri.002G173750 [exp]	0	1
AT1G07400			HSP20-like chaperones superfam...		Potri.018G140600 [exp]	12.24	0.8158	Pt-HSP17.2
AT5G41990		EIP1, ATWNK8, W...	EMF1-Interacting Protein 1, wi...		Potri.003G145300 [exp]	16.76	0.8436	WNK8.3
AT3G56740			Ubiquitin-associated (UBA) pro...		Potri.016G035800 [exp]	17.49	0.8310
AT3G28610			P-loop containing nucleoside t...		Potri.012G072300 [exp]	20.44	0.8090
AT5G67580	MYB	ATTBP3, TRB2, A...	TELOMERE-BINDING PROTEIN 3, TE...		Potri.007G005000 [exp]	22.84	0.8425	SMH905
AT5G20890			TCP-1/cpn60 chaperonin family ...		Potri.006G128600 [exp]	37.08	0.8384
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Potri.016G095500 [exp]	38.80	0.8330
AT4G10150			RING/U-box superfamily protein...		Potri.013G095100 [exp]	38.98	0.7968
AT2G23090			Uncharacterised protein family...		Potri.009G090800 [exp]	40.63	0.8184
AT3G52105			unknown protein		Potri.009G061800 [exp]	44.27	0.8330

Compare expression of checked genes

Potri.002G173750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.