Potri.002G174400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01230 254 / 3e-88 ORMDL family protein (.1)
AT5G42000 246 / 3e-85 ORMDL family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G101000 277 / 4e-97 AT1G01230 285 / 3e-100 ORMDL family protein (.1)
Potri.003G144600 253 / 1e-87 AT5G42000 281 / 8e-99 ORMDL family protein (.1.2)
Potri.001G086300 247 / 1e-85 AT5G42000 273 / 1e-95 ORMDL family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005980 261 / 7e-91 AT1G01230 295 / 1e-104 ORMDL family protein (.1)
Lus10023031 245 / 2e-84 AT5G42000 270 / 1e-94 ORMDL family protein (.1.2)
Lus10033219 243 / 6e-84 AT5G42000 271 / 5e-95 ORMDL family protein (.1.2)
Lus10030232 245 / 1e-77 AT1G09880 661 / 0.0 Rhamnogalacturonate lyase family protein (.1)
Lus10003209 164 / 2e-53 AT5G42000 194 / 2e-65 ORMDL family protein (.1.2)
Lus10017314 157 / 4e-50 AT5G42000 197 / 3e-66 ORMDL family protein (.1.2)
Lus10031614 74 / 1e-17 AT2G40190 81 / 1e-20 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04061 ORMDL ORMDL family
Representative CDS sequence
>Potri.002G174400.1 pacid=42777841 polypeptide=Potri.002G174400.1.p locus=Potri.002G174400 ID=Potri.002G174400.1.v4.1 annot-version=v4.1
ATGGCGAATTTGTATGTGACGGCGGTGCCAACGGCGGATCTGAACAGGAACACGGAGTGGTTCATGTATCCAGGGGTTTGGACCACTTACATATTAATAT
TGTTCTTTTTTTGGCTCATTGTTCTTGCTATCTTTGGTTGCTCTCCTGGCTTGGCCTGGACCATCGTCAATCTCTCTCACTTCGCTATCACTTATCACTT
TTTCCACTGGAAGAAAGGAACCCCATTTGCTGAAGACCAGGGGATCTATAATCGGCTGACCTGGTGGGAACAGATAGATAAAGGGAAGCAGCTTACACGC
AACAGAAAGTTTCTAACTGTTGTACCTGTGGTGCTGTACTTGATAGCCTCACACACCACTGACTATCAACATCCAATGCTCATTTTCAACACTCTTGCTG
TGATGGTGCTTGTTGTTGCCAAGTTCCCGAATATGCACAAGGTTCGGATCTTTGGAATAAATGCAGACAAGTAA
AA sequence
>Potri.002G174400.1 pacid=42777841 polypeptide=Potri.002G174400.1.p locus=Potri.002G174400 ID=Potri.002G174400.1.v4.1 annot-version=v4.1
MANLYVTAVPTADLNRNTEWFMYPGVWTTYILILFFFWLIVLAIFGCSPGLAWTIVNLSHFAITYHFFHWKKGTPFAEDQGIYNRLTWWEQIDKGKQLTR
NRKFLTVVPVVLYLIASHTTDYQHPMLIFNTLAVMVLVVAKFPNMHKVRIFGINADK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G01230 ORMDL family protein (.1) Potri.002G174400 0 1
AT1G33970 P-loop containing nucleoside t... Potri.019G077300 1.73 0.9044
AT1G56423 unknown protein Potri.005G017400 4.00 0.8805
AT3G58130 N-acetylglucosaminylphosphatid... Potri.012G041700 5.91 0.8971
AT5G55000 FIP2 potassium channel tetramerisat... Potri.019G038400 6.70 0.8688
AT1G68000 ATPIS1 phosphatidylinositol synthase ... Potri.009G135500 6.92 0.8634
AT5G03740 C2H2ZnF HD2C, HDT3 HISTONE DEACETYLASE 3, histone... Potri.006G116500 7.34 0.8595
AT1G76200 unknown protein Potri.002G012700 9.48 0.8793
AT5G18920 Cox19-like CHCH family protein... Potri.010G028000 9.59 0.8419
AT3G15395 unknown protein Potri.001G402000 9.89 0.8699
AT3G19184 B3 AP2/B3-like transcriptional fa... Potri.004G141800 10.53 0.8134

Potri.002G174400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.