Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) AT3G61900 131 / 1e-40 SAUR-like auxin-responsive protein family (.1) AT4G00880 127 / 4e-39 SAUR-like auxin-responsive protein family (.1) AT5G53590 91 / 1e-24 SAUR-like auxin-responsive protein family (.1) AT4G12410 81 / 2e-20 SAUR-like auxin-responsive protein family (.1) AT3G60690 78 / 3e-19 SAUR-like auxin-responsive protein family (.1) AT4G22620 78 / 3e-19 SAUR-like auxin-responsive protein family (.1) AT5G20810 77 / 8e-19 SAUR-like auxin-responsive protein family (.1.2) AT2G45210 76 / 1e-18 SAUR-like auxin-responsive protein family (.1) AT3G43120 74 / 1e-17 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G103300 [exp] 177 / 3e-59 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 134 / 9e-42 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 130 / 3e-40 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.014G066900 [exp] 84 / 2e-21 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 83 / 4e-21 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 78 / 4e-19 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 74 / 3e-18 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 73 / 5e-18 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.001G060400 [exp] 74 / 4e-17 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010110 [exp] 114 / 7e-34 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1) Lus10032949 [exp] 89 / 2e-23 AT4G00880 104 / 9e-30 SAUR-like auxin-responsive protein family (.1) Lus10008845 [exp] 85 / 4e-22 AT2G46690 102 / 4e-29 SAUR-like auxin-responsive protein family (.1) Lus10030295 [exp] 84 / 2e-21 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1) Lus10012613 [exp] 77 / 7e-20 AT2G46690 78 / 2e-20 SAUR-like auxin-responsive protein family (.1) Lus10009286 [exp] 77 / 7e-19 AT3G60690 150 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10015879 [exp] 76 / 2e-18 AT3G60690 151 / 7e-47 SAUR-like auxin-responsive protein family (.1) Lus10012181 [exp] 72 / 2e-17 AT4G34770 97 / 3e-27 SAUR-like auxin-responsive protein family (.1) Lus10007564 [exp] 72 / 3e-17 AT4G34770 97 / 3e-27 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 71 / 4e-17 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.002G176400.1 pacid=42779215 polypeptide=Potri.002G176400.1.p locus=Potri.002G176400 ID=Potri.002G176400.1.v4.1 annot-version=v4.1 ATGATTATGGGTGGTGGAGAAAAGAGCCTAAAGAACTTCCACCTCCACCTGCCGAATCTTCATCATCACCATCACAAGAAGCAGGCGAGAGATGTTCCAA AAGGGTGTTTGGCAATCAAGGTGGGCCAGGGAGAGGAGCAGCAGAGATTTGTGGTGCCTGTCATATACTTCAATCACCCACTGTTCATACAGTTATTGAA GGAAGCAGAAGAAGAATATGGTTTTGATCAAAAAGGCACCATCACTATCCCTTGTCATGTGGAGGAGTTTATGTACGTCCAAGGCATGATTGACAAGGAA AAGCCCATCCATCATCACCATGTTGGATGTTTTAGGGTTTGA
AA sequence Show only first row Show all	>Potri.002G176400.1 pacid=42779215 polypeptide=Potri.002G176400.1.p locus=Potri.002G176400 ID=Potri.002G176400.1.v4.1 annot-version=v4.1 MIMGGGEKSLKNFHLHLPNLHHHHHKKQARDVPKGCLAIKVGQGEEQQRFVVPVIYFNHPLFIQLLKEAEEEYGFDQKGTITIPCHVEEFMYVQGMIDKE KPIHHHHVGCFRV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46690			SAUR-like auxin-responsive pro...		Potri.002G176400 [exp]	0	1
AT2G22570		NIC2, ATNIC1	A. THALIANA NICOTINAMIDASE 1, ...		Potri.007G116100 [exp]	4.24	0.8805
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.011G121200 [exp]	4.58	0.8893
AT5G47390	MYB		myb-like transcription factor ...		Potri.003G079500 [exp]	6.00	0.8610
AT3G58040		SINAT2	seven in absentia of Arabidops...		Potri.001G010500 [exp]	8.00	0.8197
AT1G78340		ATGSTU22	glutathione S-transferase TAU ...		Potri.019G130566 [exp]	9.79	0.8403
AT3G22550			Protein of unknown function (D...		Potri.002G050800 [exp]	11.35	0.8105
AT5G13330	AP2_ERF	RAP2.6L	related to AP2 6l (.1)		Potri.003G162500 [exp]	12.64	0.8590
AT3G06490	MYB	BOS1, AtMYB108	BOTRYTIS-SUSCEPTIBLE1, myb dom...		Potri.010G149900 [exp]	12.80	0.8601
AT4G14450		ATBET12	unknown protein		Potri.008G164801 [exp]	14.83	0.8317
AT3G63010		ATGID1B, GID1B	GA INSENSITIVE DWARF1B, alpha/...		Potri.014G135900 [exp]	20.44	0.8147

Compare expression of checked genes

Potri.002G176400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.