Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56070 105 / 2e-28 LOS1, AT1G56075.1 LOW EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1, Ribosomal protein S5/Elongation factor G/III/V family protein (.1) AT3G12915 105 / 3e-28 Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2) AT1G06220 49 / 3e-08 GFA1, CLO, MEE5 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2) AT5G25230 48 / 5e-08 Ribosomal protein S5/Elongation factor G/III/V family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G065700 [exp] 108 / 2e-29 AT1G56070 1623 / 0.0 LOW EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1, Ribosomal protein S5/Elongation factor G/III/V family protein (.1) Potri.007G065600 [exp] 108 / 2e-29 AT1G56070 1620 / 0.0 LOW EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1, Ribosomal protein S5/Elongation factor G/III/V family protein (.1) Potri.005G098100 [exp] 108 / 3e-29 AT1G56070 1648 / 0.0 LOW EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1, Ribosomal protein S5/Elongation factor G/III/V family protein (.1) Potri.018G114900 [exp] 49 / 3e-08 AT1G06220 1710 / 0.0 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2) Potri.006G190600 [exp] 49 / 3e-08 AT1G06220 1744 / 0.0 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031763 [exp] 106 / 2e-28 AT1G56070 1418 / 0.0 LOW EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1, Ribosomal protein S5/Elongation factor G/III/V family protein (.1) Lus10031186 [exp] 104 / 3e-28 AT1G56070 902 / 0.0 LOW EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1, Ribosomal protein S5/Elongation factor G/III/V family protein (.1) Lus10031201 [exp] 105 / 5e-28 AT1G56070 1415 / 0.0 LOW EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1, Ribosomal protein S5/Elongation factor G/III/V family protein (.1) Lus10031129 [exp] 48 / 7e-08 AT1G06220 1751 / 0.0 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2) Lus10034111 [exp] 48 / 8e-08 AT1G06220 1761 / 0.0 MATERNAL EFFECT EMBRYO ARREST 5, GAMETOPHYTE FACTOR 1, CLOTHO, Ribosomal protein S5/Elongation factor G/III/V family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G177032.1 pacid=42780113 polypeptide=Potri.002G177032.1.p locus=Potri.002G177032 ID=Potri.002G177032.1.v4.1 annot-version=v4.1 ATGATGATGCTTACGCCAATGCTATCAGGGATTGTGACCCCGAAGGCCCCTGCTTCTGACAAAAGTAGGTTCTTTGTTTTCGGGCGTATTTTCTCTGGAA AGGTACCCACTGGTCTGAAGGTTGGGATCATGGGACCAAACCATGTCCCTGGTGAGAAGAAGGACCTGTATGTGAAGAGTGTGCAGAGAACCGTCATTTG GATGAGAAAGAGGCAAGAAACCGTTTAG
AA sequence Show only first row Show all	>Potri.002G177032.1 pacid=42780113 polypeptide=Potri.002G177032.1.p locus=Potri.002G177032 ID=Potri.002G177032.1.v4.1 annot-version=v4.1 MMMLTPMLSGIVTPKAPASDKSRFFVFGRIFSGKVPTGLKVGIMGPNHVPGEKKDLYVKSVQRTVIWMRKRQETV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G56070		LOS1, AT1G56075...	LOW EXPRESSION OF OSMOTICALLY ...		Potri.002G177032 [exp]	0	1
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.010G056000 [exp]	3.87	0.8584
AT5G03190		CPuORF47	conserved peptide upstream ope...		Potri.016G088850 [exp]	5.19	0.7941
AT2G27228		CPuORF6	conserved peptide upstream ope...		Potri.001G216800 [exp]	5.29	0.8580
AT1G58122		CPuORF45	conserved peptide upstream ope...		Potri.007G113150 [exp]	6.48	0.8578
AT5G51280			DEAD-box protein abstrakt, put...		Potri.005G047301 [exp]	7.41	0.8485
AT3G17770			Dihydroxyacetone kinase (.1)		Potri.011G011650 [exp]	8.48	0.8381
					Potri.005G187000 [exp]	10.81	0.8379
AT5G14950		GMII, ATGMII	golgi alpha-mannosidase II (.1...		Potri.008G117400 [exp]	11.00	0.8346
AT5G50011		CPuORF37	conserved peptide upstream ope...		Potri.005G158000 [exp]	12.12	0.8027
AT2G16880			Pentatricopeptide repeat (PPR)...		Potri.008G044050 [exp]	12.96	0.8281

Compare expression of checked genes

Potri.002G177032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.