Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATCG00670 191 / 6e-62 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT1G02560 83 / 5e-19 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT5G23140 77 / 4e-17 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT1G12410 77 / 5e-17 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT1G66670 74 / 1e-15 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) AT5G45390 70 / 4e-14 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G11750 60 / 9e-11 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) ATCG00680 53 / 4e-08 ATCG00680.1, PSBB photosystem II reaction center protein B (.1) AT4G17040 47 / 4e-06 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G195200 [exp] 82 / 2e-18 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.014G119700 [exp] 82 / 2e-18 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.004G092100 [exp] 81 / 5e-18 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.001G115900 [exp] 77 / 7e-17 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Potri.007G071700 [exp] 77 / 7e-17 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.005G092600 [exp] 76 / 1e-16 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.003G103300 [exp] 73 / 3e-15 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.004G152900 [exp] 68 / 1e-13 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.009G114001 [exp] 68 / 1e-13 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013434 [exp] 82 / 8e-19 AT5G23140 347 / 3e-121 nuclear-encoded CLP protease P7 (.1) Lus10040981 [exp] 82 / 2e-18 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10006595 [exp] 81 / 5e-18 ATCG00670 144 / 5e-42 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) Lus10002422 [exp] 79 / 1e-17 AT1G02560 361 / 4e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10001450 [exp] 79 / 4e-17 AT1G02560 365 / 1e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10040982 [exp] 77 / 1e-16 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10010196 [exp] 76 / 2e-16 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10017397 [exp] 76 / 2e-16 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10000449 [exp] 68 / 2e-13 AT1G66670 285 / 1e-95 CLP protease proteolytic subunit 3 (.1) Lus10010979 [exp] 67 / 3e-13 AT1G66670 288 / 6e-97 CLP protease proteolytic subunit 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [poplar] [flax] ClpP_crotonase PF00574 [poplar] [flax] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Potri.002G178801.1 pacid=42778631 polypeptide=Potri.002G178801.1.p locus=Potri.002G178801 ID=Potri.002G178801.1.v4.1 annot-version=v4.1 ATGGGTCAGAAGGATCAAAACCTGCTATTTCATAAAGAGACATCGAGCAAGCCCAACCAACAACTAAAGCTATATTCATTATATGGACAATCAACAAACG ATCAGGATCATTCAATACAATGCCCTTTTCGAAATCCTAAAGAGGATAGTTTAAATTGGAATGACGTATCATACGACATATCAGAGACATTGGGTCAAGA TATTGATAGTGAAATCCCGAATCAAGATATCTATCTTATGGTATATTTCAATATAGAAAGTGAGATCAAAAATTTATATTTATTTATGAACTCTCCTAAC GGATGGGTAATACCCAGAATAACTATTTATGATACTATGCAATTTGTGCTACCAGTTGTACAAACAGTATGCATGGGATTAGTTGTTTCAATGAGATCTT TTATTCTGGTCGGAGGAAAAATTACCAAACATCTAGCATTCCCTCACGCTTGTGAACTTTTTATGCGAGATAAAGTAATGATCCATCAACCTATTGCTAC ATTTTATGAAGCACAAATAGAAGAATTTGTCCTTGAAGCTGTATTTAAAGACATGGAAAGGGATGTTTTTATGGTAGCAGCAGAAGCCCAAGTTCATGGA ATTGTTAATCTTGAAGCAGTTGCATAA
AA sequence Show only first row Show all	>Potri.002G178801.1 pacid=42778631 polypeptide=Potri.002G178801.1.p locus=Potri.002G178801 ID=Potri.002G178801.1.v4.1 annot-version=v4.1 MGQKDQNLLFHKETSSKPNQQLKLYSLYGQSTNDQDHSIQCPFRNPKEDSLNWNDVSYDISETLGQDIDSEIPNQDIYLMVYFNIESEIKNLYLFMNSPN GWVIPRITIYDTMQFVLPVVQTVCMGLVVSMRSFILVGGKITKHLAFPHACELFMRDKVMIHQPIATFYEAQIEEFVLEAVFKDMERDVFMVAAEAQVHG IVNLEAVA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
ATCG00670		PCLPP, ATCG0067...	CASEINOLYTIC PROTEASE P 1, pla...		Potri.002G178801 [exp]	0	1
AT2G17950	HD	WUS1, PGA6, WUS	WUSCHEL 1, WUSCHEL, Homeodomai...		Potri.007G012100 [exp]	16.00	0.6960
AT2G12646			PLATZ transcription factor fam...		Potri.018G116000 [exp]	19.97	0.6736
					Potri.007G076750 [exp]	22.84	0.5392
AT1G70560		CKRC1, WEI8, TA...	WEAK ETHYLENE INSENSITIVE 8, S...		Potri.010G044500 [exp]	23.91	0.6899
AT4G32150		ATVAMP711, VAMP...	vesicle-associated membrane pr...		Potri.018G125900 [exp]	28.56	0.6761
AT2G35750			unknown protein		Potri.006G016001 [exp]	28.80	0.7143
AT1G04645			Plant self-incompatibility pro...		Potri.018G148630 [exp]	29.39	0.6761
AT1G68510	AS2	LBD42	LOB domain-containing protein ...		Potri.008G120600 [exp]	36.00	0.6594
AT4G38040			Exostosin family protein (.1)		Potri.012G091600 [exp]	53.96	0.6194
					Potri.005G020350 [exp]	60.79	0.6732

Compare expression of checked genes

Potri.002G178801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.