Plant FIBer expression Database

Potri.002G179000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61930 51 / 1e-09 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G105000
[exp]
140 / 7e-45 AT3G61930 43 / 3e-06 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002685
[exp]
56 / 1e-11 AT3G61930 45 / 4e-07 unknown protein
Lus10030203
[exp]
50 / 5e-09 AT3G61930 44 / 1e-06 unknown protein
PFAM info
Representative CDS sequence
>Potri.002G179000.1 pacid=42778908 polypeptide=Potri.002G179000.1.p locus=Potri.002G179000 ID=Potri.002G179000.1.v4.1 annot-version=v4.1
ATGGGCAATTGGTTTTCCAGAAAGTATCTGGCGGTGCATCCAATGGACCAAGATGGCGAAGATATCGTTAAAAGCAGCCTCATTACTCCATCATCAAGCA
GCTTAAGAATCAAGGTTCGTATGACTACAACGCAACTAGAAGAGTTGATGGCGCTGGCGGATTTGAGCGAAGGAAGTTCGGATCTTGGTCGCGTGATCCT
GCAAGAATGCTTAGATGGCAGGTTTCGTGCTCGTGTTGTCGTTGGTGATGAAGGTTTGCTGTCATCGGAATATGCAAGGAATCTATATACCATCAAGGAA
GAGTAA
AA sequence
>Potri.002G179000.1 pacid=42778908 polypeptide=Potri.002G179000.1.p locus=Potri.002G179000 ID=Potri.002G179000.1.v4.1 annot-version=v4.1
MGNWFSRKYLAVHPMDQDGEDIVKSSLITPSSSSLRIKVRMTTTQLEELMALADLSEGSSDLGRVILQECLDGRFRARVVVGDEGLLSSEYARNLYTIKE
E

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G61930 unknown protein Potri.002G179000
[exp]
0 1
AT5G52600 MYB AtMYB82 myb domain protein 82 (.1) Potri.018G127700
[exp]
2.82 0.9119
AT5G06740 Concanavalin A-like lectin pro... Potri.011G146500
[exp]
2.82 0.8995
Potri.012G120952
[exp]
3.46 0.9130
AT3G63380 ATPase E1-E2 type family prote... Potri.002G047500
[exp]
7.21 0.8734
AT1G13080 CYP71B2 "cytochrome P450, family 71, s... Potri.015G028000
[exp]
8.36 0.8994
AT5G06790 unknown protein Potri.016G047800
[exp]
8.48 0.8976
AT4G01500 B3 NGA4 NGATHA4, AP2/B3-like transcrip... Potri.012G013000
[exp]
9.48 0.8882
AT4G03230 S-locus lectin protein kinase ... Potri.019G119900
[exp]
10.95 0.8955
Potri.012G120768
[exp]
12.36 0.8940
AT3G18670 Ankyrin repeat family protein ... Potri.015G119800
[exp]
13.03 0.8844

Potri.002G179000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.