Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01575 102 / 1e-28 serine protease inhibitor, Kazal-type family protein (.1) AT3G61980 93 / 2e-25 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G108600 [exp] 171 / 2e-56 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.015G001800 [exp] 80 / 6e-20 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108700 [exp] 68 / 5e-16 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G109000 [exp] 61 / 5e-13 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108900 [exp] 57 / 1e-11 AT3G61980 67 / 5e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108800 [exp] 46 / 1e-07 AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007864 [exp] 110 / 7e-32 AT4G01575 129 / 4e-39 serine protease inhibitor, Kazal-type family protein (.1) Lus10030166 [exp] 109 / 2e-31 AT4G01575 134 / 2e-41 serine protease inhibitor, Kazal-type family protein (.1) Lus10010287 [exp] 69 / 5e-16 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1) Lus10009866 [exp] 65 / 1e-14 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Lus10010285 [exp] 62 / 9e-14 AT3G61980 66 / 3e-15 serine protease inhibitor, Kazal-type family protein (.1) Lus10010286 [exp] 62 / 1e-13 AT4G01575 63 / 3e-14 serine protease inhibitor, Kazal-type family protein (.1) Lus10010094 [exp] 61 / 5e-13 AT4G01575 61 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1) Lus10030164 [exp] 57 / 2e-11 AT4G01575 59 / 8e-13 serine protease inhibitor, Kazal-type family protein (.1) Lus10009865 [exp] 54 / 3e-10 AT4G01575 56 / 3e-11 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G182800.1 pacid=42779019 polypeptide=Potri.002G182800.1.p locus=Potri.002G182800 ID=Potri.002G182800.1.v4.1 annot-version=v4.1 ATGTCGAAATTCTCAGCAATTTTCACATGCGTCACTATTTTCTTATTGAGCAGTCTCTGCTTCCCGATCGCGCTATCGGAAACTGGCGCTGGAATATTGA TTCAAGAAGTCACAAGAGAGGATGGTAAGGGTGATGCATGCGCAGGATTAAAAGCACCCGCTTCATGTCCGATCAATTGTTTCCGTGCGGACCCCGTGTG TGGCGTCGATGGCGTTACTTATTGGTGTGGGTGCGCTGACGCTTTGTGCAGTGGCACTCGTGTTGATAAATTAGGGGCTTGTGAGGTTGGGAGTGGAGGG AGCTCTTCTCTTCCTGGTCAGGCACTTCTTTTGATTCATATTGTCTGGCTTATCTTGCTTGGGTTTTCTCTCTTGTTTGGGTTTTTTTAA
AA sequence Show only first row Show all	>Potri.002G182800.1 pacid=42779019 polypeptide=Potri.002G182800.1.p locus=Potri.002G182800 ID=Potri.002G182800.1.v4.1 annot-version=v4.1 MSKFSAIFTCVTIFLLSSLCFPIALSETGAGILIQEVTREDGKGDACAGLKAPASCPINCFRADPVCGVDGVTYWCGCADALCSGTRVDKLGACEVGSGG SSSLPGQALLLIHIVWLILLGFSLLFGFF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G01575			serine protease inhibitor, Kaz...		Potri.002G182800 [exp]	0	1
AT1G26670		VTI1B, ATVTI12,...	VESICAL TRANSPORT V-SNARE 12, ...		Potri.010G164300 [exp]	2.82	0.8879	VTI12.2
					Potri.006G056101 [exp]	8.48	0.8990
AT5G55990		ATCBL2, CBL2	calcineurin B-like protein 2 (...		Potri.006G002900 [exp]	9.79	0.8847
AT2G33120		ATVAMP722, SAR1	ARABIDOPSIS THALIANA VESICLE-A...		Potri.001G050400 [exp]	12.60	0.8974
AT3G51730			saposin B domain-containing pr...		Potri.006G107300 [exp]	13.07	0.8800
AT1G71190		TTN4, SAG18	senescence associated gene 18 ...		Potri.001G211600 [exp]	17.23	0.8626
AT3G18660		PGSIP1, GUX1	glucuronic acid substitution o...		Potri.005G061600 [exp]	20.24	0.8876
AT1G27500			Tetratricopeptide repeat (TPR)...		Potri.015G075300 [exp]	20.59	0.8802
AT4G17960			unknown protein		Potri.003G090600 [exp]	22.44	0.8636
AT4G27435			Protein of unknown function (D...		Potri.011G122700 [exp]	26.58	0.8832

Compare expression of checked genes

Potri.002G182800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.