Potri.002G184201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02305 500 / 6e-179 Cysteine proteinases superfamily protein (.1)
AT4G01610 498 / 3e-178 Cysteine proteinases superfamily protein (.1.2)
AT1G02300 468 / 4e-166 Cysteine proteinases superfamily protein (.1)
AT3G45310 100 / 1e-23 Cysteine proteinases superfamily protein (.1.2)
AT3G43960 94 / 3e-21 Cysteine proteinases superfamily protein (.1)
AT5G60360 93 / 6e-21 SAG2, AALP SENESCENCE ASSOCIATED GENE2, aleurain-like protease (.1.2.3)
AT3G19400 87 / 9e-19 Cysteine proteinases superfamily protein (.1.2)
AT1G29080 86 / 9e-19 Papain family cysteine protease (.1)
AT3G49340 82 / 3e-17 Cysteine proteinases superfamily protein (.1)
AT2G34080 82 / 4e-17 Cysteine proteinases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G109801 630 / 0 AT1G02305 515 / 0.0 Cysteine proteinases superfamily protein (.1)
Potri.002G184300 577 / 0 AT1G02305 550 / 0.0 Cysteine proteinases superfamily protein (.1)
Potri.006G141700 98 / 8e-23 AT3G45310 590 / 0.0 Cysteine proteinases superfamily protein (.1.2)
Potri.004G055900 97 / 2e-22 AT5G45890 438 / 5e-155 senescence-associated gene 12 (.1)
Potri.004G056000 95 / 6e-22 AT5G45890 417 / 2e-146 senescence-associated gene 12 (.1)
Potri.004G056500 95 / 6e-22 AT5G45890 417 / 2e-146 senescence-associated gene 12 (.1)
Potri.004G056366 94 / 2e-21 AT5G45890 416 / 5e-146 senescence-associated gene 12 (.1)
Potri.004G056100 92 / 6e-21 AT5G45890 419 / 2e-147 senescence-associated gene 12 (.1)
Potri.004G056258 92 / 9e-21 AT5G45890 417 / 8e-147 senescence-associated gene 12 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007212 525 / 0 AT1G02305 532 / 0.0 Cysteine proteinases superfamily protein (.1)
Lus10010091 510 / 5e-178 AT1G02305 520 / 0.0 Cysteine proteinases superfamily protein (.1)
Lus10042693 101 / 6e-24 AT5G45890 379 / 1e-131 senescence-associated gene 12 (.1)
Lus10029658 99 / 3e-23 AT5G45890 383 / 4e-133 senescence-associated gene 12 (.1)
Lus10042691 95 / 2e-22 AT5G50260 321 / 5e-110 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10033428 93 / 8e-21 AT3G45310 565 / 0.0 Cysteine proteinases superfamily protein (.1.2)
Lus10029649 91 / 4e-20 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Lus10002184 85 / 3e-18 AT1G06260 384 / 1e-133 Cysteine proteinases superfamily protein (.1)
Lus10015286 82 / 3e-17 AT5G45890 393 / 7e-137 senescence-associated gene 12 (.1)
Lus10002199 82 / 3e-17 AT5G45890 361 / 2e-124 senescence-associated gene 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
CL0125 PF08127 Propeptide_C1 Peptidase family C1 propeptide
Representative CDS sequence
>Potri.002G184201.2 pacid=42777393 polypeptide=Potri.002G184201.2.p locus=Potri.002G184201 ID=Potri.002G184201.2.v4.1 annot-version=v4.1
ATGGCAAGTCCTCTGTATCTTGGCACTCTCTTCTTACTCGTCGCTGCTCTCTTTACCTTCCGCTCTCAGGTTATTGCGGTGGAACCAGTTTCCAAGCTCA
AACTCAATTCTAGGATCCTTCAGGATTCAATAGTTCAAAAGGTCAATGAAAATCCCAATGCTGGATGGGAAGCTACCATGAACCCTCAATTTTCCAATTA
CTCTGTTGGGGAATTCAAGTACCTTCTTGGAGTCAAACCAACACCTGGAAAGGAACTAAGAGGTGTTCCTCTAGTAAGGCATCCAAAATCGATGAAATTA
CCAAAAGAATTTGATGCAAGAACCGCTTGGCCACATTGTAGCACCATTGGAAGAATTCTTGATCAGGGTCACTGTGGATCCTGTTGGGCATTTGGTGCTG
TTGAATCGCTATCAGATCGTTTTTGCATCCATTATGGCATGAACCTCTCTCTATCCGTCAATGACCTCTTAGCTTGCTGTGGCTGGATGTGCGGTGATGG
TTGTGATGGGGGTTATCCAATTGATGCATGGAGATACTTTGTCCAATCTGGTGTTGTCACTGAGGAGTGTGATCCATACTTTGATGATATTGGCTGTTCT
CACCCTGGTTGCGAGCCAGGATTTCCTACTCCAAAGTGTGAAAGAAAATGTGCCGATAAGAACAAGCTCTGGGCAGAGTCCAAGCACTTCAGTGTTAATG
CTTATAGAATTGATTCTGATCCCCACAGCATCATGGCTGAAGTTTCCATGAACGGACCTGTAGAGGTGGCCTTCACTGTTTATGAGGATTTTGCTCATTA
TAAATCAGGAGTTTACAAGCACATAACAGGTGATGTCATGGGAGGCCATGCTGTTAAGCTTATCGGGTGGGGGACTTCTGATGACGGGGAGGATTATTGG
CTTCTTGCTAACCAGTGGAATAGAGGCTGGGGTGATGATGGCTACTTTAAAATCAGAAGAGGAACAAATGAGTGTGGTATTGAAGAGGATGTTGTTGCTG
GTTTGCCTTCAACCAGGAACCTCGTCAGAGAAGTTGCCAAGATCGATGCCCATGAGCATGCCTCGGCGTGA
AA sequence
>Potri.002G184201.2 pacid=42777393 polypeptide=Potri.002G184201.2.p locus=Potri.002G184201 ID=Potri.002G184201.2.v4.1 annot-version=v4.1
MASPLYLGTLFLLVAALFTFRSQVIAVEPVSKLKLNSRILQDSIVQKVNENPNAGWEATMNPQFSNYSVGEFKYLLGVKPTPGKELRGVPLVRHPKSMKL
PKEFDARTAWPHCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHYGMNLSLSVNDLLACCGWMCGDGCDGGYPIDAWRYFVQSGVVTEECDPYFDDIGCS
HPGCEPGFPTPKCERKCADKNKLWAESKHFSVNAYRIDSDPHSIMAEVSMNGPVEVAFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYW
LLANQWNRGWGDDGYFKIRRGTNECGIEEDVVAGLPSTRNLVREVAKIDAHEHASA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G02305 Cysteine proteinases superfami... Potri.002G184201 0 1
AT5G13800 CRN1, PPH Co-regulated with NYE1, pheoph... Potri.009G054800 1.41 0.9630
AT1G06050 Protein of unknown function (D... Potri.007G130400 1.41 0.9577
AT4G22920 ATNYE1, SGR1, S... non-yellowing 1 (.1) Potri.003G119600 1.73 0.9575
AT5G43060 Granulin repeat cysteine prote... Potri.014G024100 2.64 0.9423 RD21.1
AT1G03400 2-oxoglutarate (2OG) and Fe(II... Potri.010G107500 2.82 0.9566
AT5G04250 Cysteine proteinases superfami... Potri.008G036900 3.00 0.9399
AT5G43260 chaperone protein dnaJ-related... Potri.001G056601 7.34 0.9289
AT1G80300 ATNTT1 nucleotide transporter 1 (.1) Potri.003G058900 7.93 0.9267 AATP1.2
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Potri.006G022500 8.94 0.9380
AT5G22510 INV-E, At-A/N-I... Arabidopsis alkaline/neutral i... Potri.010G236100 9.38 0.9401

Potri.002G184201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.