Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	IAA4.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62100 146 / 3e-45 AUX_IAA IAA30 indole-3-acetic acid inducible 30 (.1) AT2G46990 131 / 3e-39 AUX_IAA IAA20 indole-3-acetic acid inducible 20 (.1) AT3G17600 117 / 9e-34 AUX_IAA IAA31 indole-3-acetic acid inducible 31 (.1) AT5G43700 96 / 5e-25 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT1G04240 95 / 1e-24 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT4G28640 92 / 4e-23 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT2G33310 91 / 9e-23 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT1G04550 91 / 1e-22 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT3G23030 82 / 4e-20 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1) AT3G15540 83 / 6e-20 AUX_IAA MSG2, IAA19 MASSUGU 2, indole-3-acetic acid inducible 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G111700 [exp] 257 / 8e-89 AT3G62100 150 / 7e-47 indole-3-acetic acid inducible 30 (.1) Potri.013G041300 [exp] 99 / 6e-26 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 95 / 1e-24 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G172400 [exp] 91 / 2e-22 AT2G33310 246 / 4e-81 auxin-induced protein 13 (.1.2.3) Potri.010G065200 [exp] 91 / 3e-22 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.008G161100 [exp] 88 / 8e-22 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.010G078400 [exp] 87 / 8e-22 AT5G43700 248 / 9e-85 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G256600 [exp] 89 / 1e-21 AT4G28640 191 / 6e-60 indole-3-acetic acid inducible 11 (.1.2.3) Potri.006G255200 [exp] 87 / 2e-21 AT4G32280 137 / 7e-40 indole-3-acetic acid inducible 29 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009967 [exp] 144 / 2e-44 AT3G62100 128 / 2e-38 indole-3-acetic acid inducible 30 (.1) Lus10038025 [exp] 143 / 8e-44 AT3G62100 127 / 1e-37 indole-3-acetic acid inducible 30 (.1) Lus10007193 [exp] 135 / 8e-41 AT3G62100 117 / 4e-34 indole-3-acetic acid inducible 30 (.1) Lus10010081 [exp] 132 / 1e-39 AT2G46990 115 / 4e-33 indole-3-acetic acid inducible 20 (.1) Lus10014464 [exp] 93 / 8e-23 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10023719 [exp] 92 / 2e-22 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10039488 [exp] 89 / 2e-22 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10039413 [exp] 89 / 3e-22 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10042929 [exp] 89 / 5e-21 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2) Lus10002723 [exp] 86 / 6e-21 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF02309 [poplar] [flax] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Potri.002G186400.1 pacid=42777116 polypeptide=Potri.002G186400.1.p locus=Potri.002G186400 ID=Potri.002G186400.1.v4.1 annot-version=v4.1 ATGGGCAGAGGAGCTGCCTCTAGCTCTTCATCATCTTTCGAAAGCAGCCGCTACCCATCTGTCTCCGGCGAGTCTTCTTTCCCTCATGTAAAGAGGGACC TTAGCACAGATCTAAGGCTTGGACTTGGCATATCAACCTCTCGACAGGACAACCCTTCCACACCAAGTGAGCAGCTATTGGATTGGCCACCGATCAAGCC GTCTCCGGGGAAGGCAGTAACATCAGAAGAAAATGAGTGCTGTAGTTCCACCTTATTCGTCAAGGTGTACATGGAAGGCATTCAAATTGGAAGGAAACTG AACCTATTAGCCCACGATGGTTACCATGACTTGATACAGACTCTCGACGAAATGTTCAACACTAGCATTCTCTGGCCTGAAATGGATGTTGAACATTCCG GGAAATGCCATGTGCTGACATATGAAGACAAAGAGGGCGATTGGTTGATTGTTGGGGATGTTCCATGGGAGGTGTTCTTACCTTCTGTGCGGAGATTGAA GATCACCAGGGCAGACAGCCTATGA
AA sequence Show only first row Show all	>Potri.002G186400.1 pacid=42777116 polypeptide=Potri.002G186400.1.p locus=Potri.002G186400 ID=Potri.002G186400.1.v4.1 annot-version=v4.1 MGRGAASSSSSSFESSRYPSVSGESSFPHVKRDLSTDLRLGLGISTSRQDNPSTPSEQLLDWPPIKPSPGKAVTSEENECCSSTLFVKVYMEGIQIGRKL NLLAHDGYHDLIQTLDEMFNTSILWPEMDVEHSGKCHVLTYEDKEGDWLIVGDVPWEVFLPSVRRLKITRADSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G62100	AUX_IAA	IAA30	indole-3-acetic acid inducible...		Potri.002G186400 [exp]	0	1	IAA4.1
AT4G05430			Carbohydrate-binding X8 domain...		Potri.007G111000 [exp]	3.74	0.8761
AT3G19660			unknown protein		Potri.004G105900 [exp]	4.24	0.8565
AT1G06475			unknown protein		Potri.002G058400 [exp]	6.00	0.8602
AT5G02440			unknown protein		Potri.001G238900 [exp]	7.48	0.8240
AT5G38895			RING/U-box superfamily protein...		Potri.010G140300 [exp]	13.07	0.8223
AT5G24620			Pathogenesis-related thaumatin...		Potri.012G004800 [exp]	14.69	0.7870
AT5G49890		ATCLC-C, CLC-C	chloride channel C (.1)		Potri.003G001500 [exp]	14.83	0.8143	CLC.3
AT2G23530			Zinc-finger domain of monoamin...		Potri.009G108400 [exp]	18.57	0.7955
AT1G09815		POLD4	polymerase delta 4 (.1)		Potri.013G076400 [exp]	19.49	0.8188
AT3G26350			unknown protein		Potri.010G049000 [exp]	20.49	0.8463

Compare expression of checked genes

Potri.002G186400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.