Plant FIBer expression Database

Potri.002G190900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF15699 NPR1_interact NPR1 interacting
Representative CDS sequence
>Potri.002G190900.1 pacid=42779010 polypeptide=Potri.002G190900.1.p locus=Potri.002G190900 ID=Potri.002G190900.1.v4.1 annot-version=v4.1
ATGAAGAGAAAGTACAGCATGGAAGGAGAAAGAAGAGAGGGAAATATGGTGGTTGATGAAGAAGAAGAGAAGATCAACGCTTTTTACACTTTGGTTAGAA
ATATAAGAGATGTCCATAATCAAATGTTGAGTGGTTCCAAAGGGAAAGGGAAAGCGGAGGAAAAAGAAATGAAACCAACTTGGACCCCATCTTTCACCTG
GGAAGATTTTGCCGAGGAGGATCATCATGAGCAATTCAGAGGCAATTTTGAAATGCTCCCACCTCCTCCTCCTTCTTCCTCTAAGAATATTGACGAAGGA
CAGCAACCCACAACAGATCAGAAAAGGCAAGATCAAGATTTAGATCTCAATCTTTCACTTTGA
AA sequence
>Potri.002G190900.1 pacid=42779010 polypeptide=Potri.002G190900.1.p locus=Potri.002G190900 ID=Potri.002G190900.1.v4.1 annot-version=v4.1
MKRKYSMEGERREGNMVVDEEEEKINAFYTLVRNIRDVHNQMLSGSKGKGKAEEKEMKPTWTPSFTWEDFAEEDHHEQFRGNFEMLPPPPPSSSKNIDEG
QQPTTDQKRQDQDLDLNLSL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G190900
[exp]
0 1
AT5G10770 Eukaryotic aspartyl protease f... Potri.018G014600
[exp]
1.00 0.9546
Potri.014G115800
[exp]
1.41 0.9459
AT4G34480 O-Glycosyl hydrolases family 1... Potri.004G153800
[exp]
8.48 0.9057
AT4G08850 Leucine-rich repeat receptor-l... Potri.006G261900
[exp]
8.77 0.9199
AT2G24600 Ankyrin repeat family protein ... Potri.014G050532
[exp]
9.32 0.9433
AT4G03500 Ankyrin repeat family protein ... Potri.019G107400
[exp]
9.94 0.9284
AT1G34050 Ankyrin repeat family protein ... Potri.001G444300
[exp]
11.83 0.9146
AT4G13440 Calcium-binding EF-hand family... Potri.019G027100
[exp]
12.64 0.9338
AT1G60420 DC1 domain-containing protein ... Potri.010G059401
[exp]
13.26 0.9006
AT4G13440 Calcium-binding EF-hand family... Potri.019G026900
[exp]
13.85 0.9337

Potri.002G190900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.