Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G31425 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17152 57 / 2e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G55680 57 / 2e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G31432 46 / 1e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17150 42 / 8e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G09360 42 / 9e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G044100 [exp] 50 / 1e-07 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.016G001600 [exp] 47 / 1e-06 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.005G007100 [exp] 44 / 2e-05 AT1G09360 85 / 6e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086600 [exp] 43 / 4e-05 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023201 [exp] 42 / 0.0001 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023100 [exp] 42 / 0.0001 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.013G012800 [exp] 40 / 0.0002 ND / Potri.005G023050 [exp] 40 / 0.0005 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.007G068300 [exp] 39 / 0.0007 AT4G00872 113 / 4e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015199 [exp] 63 / 3e-12 AT5G46940 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031483 [exp] 60 / 3e-11 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038738 [exp] 52 / 2e-08 AT5G64620 67 / 4e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10020664 [exp] 51 / 2e-08 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10040145 [exp] 52 / 3e-08 ND 40 / 4e-04 Lus10017345 [exp] 51 / 5e-08 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1) Lus10029877 [exp] 51 / 6e-08 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10000961 [exp] 51 / 7e-08 ND 39 / 5e-04 Lus10001658 [exp] 50 / 1e-07 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1) Lus10017077 [exp] 48 / 4e-07 AT3G17152 76 / 1e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.002G191500.1 pacid=42777815 polypeptide=Potri.002G191500.1.p locus=Potri.002G191500 ID=Potri.002G191500.1.v4.1 annot-version=v4.1 ATGGCTTCTCCGCTTTGCTTTATTTCTTTAATCCTCCCCTTGGCGGTCATTTGTGCATGCTGCCCTTCCCGCACCGCAGCAATCAGGTTTGAAACGAAAG CCGATGCAGCGTTAGTTCAGAGCATATGCAAGGAGTCCCAGGACCCCGACTTCTGCAATAGGACTCTAGCCGTCGACCCACGTGTTGCTGCAGCCAGCAT GGATGGTTTAGCCATGTTATCTATTTCATTGACCATTGATCAATTACAAACGACATCGGATAACATTGCTAGCATTCTTGGTCAAACCAGTGACCCAGTT GGCAGGCAACGACTTGGAGTTTGCCGGACTGATTACAAGGATGCGCTAGGGCAGTTTCGTAGAGCTTCCTCTTCATCAGACGCCAGGGCTTATTGGGATG TGATCGATCGGGTTAGAGATGGAACCAACAAGGTTATAGATTGTGAAAATATTTATAAAAGAGATCCTATTAGTGTGTCACCCATCACAACTGATAACCA CAACGTTATTAAACTATCAGAGCTTACTTTGATAATTGTTGATAAGATTCTTCCGCATTAA
AA sequence Show only first row Show all	>Potri.002G191500.1 pacid=42777815 polypeptide=Potri.002G191500.1.p locus=Potri.002G191500 ID=Potri.002G191500.1.v4.1 annot-version=v4.1 MASPLCFISLILPLAVICACCPSRTAAIRFETKADAALVQSICKESQDPDFCNRTLAVDPRVAAASMDGLAMLSISLTIDQLQTTSDNIASILGQTSDPV GRQRLGVCRTDYKDALGQFRRASSSSDARAYWDVIDRVRDGTNKVIDCENIYKRDPISVSPITTDNHNVIKLSELTLIIVDKILPH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G31430			Plant invertase/pectin methyle...		Potri.002G191500 [exp]	0	1
					Potri.005G170132 [exp]	8.12	0.5476
					Potri.002G113501 [exp]	45.69	0.4698
AT3G43520			Transmembrane proteins 14C (.1...		Potri.006G217400 [exp]	68.92	0.4818
AT3G55620		eIF6A, EMB1624	embryo defective 1624, eukaryo...		Potri.005G098700 [exp]	74.89	0.4734
AT1G32583			unknown protein		Potri.012G102900 [exp]	80.19	0.4489
					Potri.003G198150 [exp]	101.81	0.4142
AT3G12680	C3HZnF	HUA1	ENHANCER OF AG-4 1, floral hom...		Potri.010G176300 [exp]	145.74	0.4364	HUA1.2
AT3G47370			Ribosomal protein S10p/S20e fa...		Potri.002G146600 [exp]	178.17	0.4246
AT5G53588		CPuORF50	conserved peptide upstream ope...		Potri.012G023450 [exp]	230.92	0.4025
AT1G61566		RALFL9	ralf-like 9 (.1)		Potri.018G007701 [exp]	233.94	0.3878

Compare expression of checked genes

Potri.002G191500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.