Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47270 79 / 6e-20 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) AT2G42870 50 / 1e-08 PAR1 ,HLH1 HELIX-LOOP-HELIX 1, phy rapidly regulated 1 (.1) AT3G58850 45 / 8e-07 HLH2, PAR2 phy rapidly regulated 2 (.1) AT3G05800 43 / 2e-05 bHLH bHLH150, AIF1 AtBS1(activation-tagged BRI1 suppressor 1)-interacting factor 1 (.1) AT3G62090 40 / 0.0001 bHLH PIF6, PIL2 PHYTOCHROME-INTERACTING FACTOR 6, phytochrome interacting factor 3-like 2 (.1.2.3) AT2G43060 39 / 0.0002 bHLH AtIBH1, bHLH158 ILI1 binding bHLH 1 (.1) AT3G06590 38 / 0.001 bHLH bHLH148, AIF2 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G118300 [exp] 206 / 1e-69 AT2G47270 62 / 2e-13 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.002G060100 [exp] 65 / 4e-14 AT3G58850 80 / 4e-20 phy rapidly regulated 2 (.1) Potri.005G201500 [exp] 65 / 5e-14 AT3G58850 82 / 4e-21 phy rapidly regulated 2 (.1) Potri.005G012400 [exp] 45 / 2e-06 AT1G09250 109 / 1e-29 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.013G007700 [exp] 44 / 5e-06 AT1G09250 95 / 4e-24 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.017G093000 [exp] 42 / 1e-05 AT5G39240 64 / 3e-14 unknown protein Potri.004G119600 [exp] 40 / 6e-05 AT5G39240 60 / 6e-13 unknown protein Potri.008G103500 [exp] 40 / 0.0001 AT3G17100 174 / 2e-54 sequence-specific DNA binding transcription factors (.1.2) Potri.018G099100 [exp] 40 / 0.0002 AT4G30410 135 / 1e-40 sequence-specific DNA binding transcription factors (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002419 [exp] 74 / 6e-18 AT2G47270 67 / 4e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10001447 [exp] 72 / 3e-17 AT2G47270 69 / 2e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10010001 [exp] 45 / 1e-06 AT2G47270 52 / 6e-10 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10025511 [exp] 42 / 3e-05 AT2G43060 98 / 9e-27 ILI1 binding bHLH 1 (.1) Lus10030844 [exp] 40 / 4e-05 AT1G23965 48 / 2e-08 unknown protein Lus10026730 [exp] 40 / 8e-05 AT2G43060 97 / 4e-26 ILI1 binding bHLH 1 (.1) Lus10030641 [exp] 39 / 0.0001 AT1G23965 42 / 3e-06 unknown protein Lus10017065 [exp] 38 / 0.001 AT3G06590 171 / 1e-53 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G193300.1 pacid=42777585 polypeptide=Potri.002G193300.1.p locus=Potri.002G193300 ID=Potri.002G193300.1.v4.1 annot-version=v4.1 ATGGGAGTTTCAGCAGGTGAGCATCCTCTTCTTGTTTCTTTGAAGGGCATGGTCCAAGGAAATGAAGAGACGATGGATCATATGCCAAATGAAGCTTTGT GGAACAAGGTCTCGGAAGCACAAACCAAGAGAAGATGCCCACTGAGGAGACAAAAAAATGGGCGGCATGCCAGGAGCAAGAGACCTGGAAGGATCTTGAT GAAGAGAAGAGCTCGTGCAGAAGGTTCTACTGTAAGGTCAGGATATGGCATCGAGAGAAGAGTTAGAACCCTGAAGAAACTCATTCCTAATAGTGAATCC ATGGGATTGGATGGGCTTTTCAGAGAGACAGCTGATTATATTTTGTCTTTGCAAATGAGAGTTAAAGTCATGCAGATAATGGTTAAGGTTTTAACAGGTT CGGATGATGAGTATTAA
AA sequence Show only first row Show all	>Potri.002G193300.1 pacid=42777585 polypeptide=Potri.002G193300.1.p locus=Potri.002G193300 ID=Potri.002G193300.1.v4.1 annot-version=v4.1 MGVSAGEHPLLVSLKGMVQGNEETMDHMPNEALWNKVSEAQTKRRCPLRRQKNGRHARSKRPGRILMKRRARAEGSTVRSGYGIERRVRTLKKLIPNSES MGLDGLFRETADYILSLQMRVKVMQIMVKVLTGSDDEY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G47270	bHLH	bHLH151, UPB1	UPBEAT1, sequence-specific DNA...		Potri.002G193300 [exp]	0	1
					Potri.018G036850 [exp]	3.46	0.7142
AT4G02390		ATPARP1, APP	POLY\(ADP-RIBOSE\) POLYMERASE ...		Potri.009G136501 [exp]	4.24	0.7727
					Potri.017G082950 [exp]	5.09	0.6843
AT3G57170			N-acetylglucosaminyl transfera...		Potri.006G044500 [exp]	7.74	0.7408
AT1G14540			Peroxidase superfamily protein...		Potri.001G458900 [exp]	8.94	0.6324
AT4G14750		IQD19	IQ-domain 19 (.1)		Potri.008G156700 [exp]	9.00	0.7486
AT1G53210			sodium/calcium exchanger famil...		Potri.004G052800 [exp]	9.16	0.7638
AT4G08690			Sec14p-like phosphatidylinosit...		Potri.005G168100 [exp]	16.52	0.6247
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G177400 [exp]	18.38	0.6071
AT3G60650			unknown protein		Potri.002G144400 [exp]	19.49	0.5639

Compare expression of checked genes

Potri.002G193300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.