Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 120 / 9e-35 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT5G49050 104 / 4e-29 unknown protein AT3G58450 94 / 2e-24 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G09740 92 / 5e-24 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G68300 88 / 2e-22 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 86 / 2e-21 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 68 / 3e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G01520 62 / 2e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03270 61 / 5e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G205275 [exp] 281 / 8e-99 AT2G47710 226 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.014G130100 [exp] 247 / 4e-85 AT2G47710 234 / 4e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G221300 [exp] 184 / 1e-59 AT2G47710 199 / 2e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 115 / 6e-33 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 111 / 1e-31 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 109 / 1e-30 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 108 / 1e-30 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G198200 [exp] 107 / 1e-29 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.016G064000 [exp] 102 / 2e-27 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006701 [exp] 216 / 4e-73 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 215 / 2e-72 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006703 [exp] 173 / 3e-56 AT2G47710 169 / 1e-54 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 118 / 3e-34 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 115 / 3e-33 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 105 / 3e-28 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 100 / 7e-27 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 101 / 2e-25 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10029310 [exp] 82 / 7e-20 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10015896 [exp] 68 / 1e-14 AT1G09740 185 / 3e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.002G193800.1 pacid=42778070 polypeptide=Potri.002G193800.1.p locus=Potri.002G193800 ID=Potri.002G193800.1.v4.1 annot-version=v4.1 ATGGCAACCTTAGAAGAGAAGCAAGTGATGGTTGTTGGGATTGATGATAGCCAGCACAGTACATACGCTTTAGAGTGGACATTTGATCACTTCTTCACTC CCCCTCTGGCTTCCAATTCACCTTTCAAGGTCGTTGTTGTCCATGCCAAAACTCCCGCTACCTCCGTCGTCGCCAGTCTCGCTGAACCTGGGATTGCTGA AGTTTTGCCACAAGTGAAATCGGACTTGAAGAAGATAGCTGCAAGAGACATCGAAAAGGCTAAGGAAATTTGCATCATTAAATCGGTGAGTGATGTGATC TTTGAAGTGGTGGAAGGTGATCCTAGAAATGTTCTTTGCGAGGCTGTAGAGAAGCACCATGCTTCAGTGCTCGTTGTAGGAAGTCATGGTTATGGAGCTA TTAAAAGGGCAGTTTTAGGTAGCGTGAGTGACTATTGCGTTCATAATGCTCGCTGCACTGTGATGATAGTGAAGAGGCCTAAGATGCCTTGA
AA sequence Show only first row Show all	>Potri.002G193800.1 pacid=42778070 polypeptide=Potri.002G193800.1.p locus=Potri.002G193800 ID=Potri.002G193800.1.v4.1 annot-version=v4.1 MATLEEKQVMVVGIDDSQHSTYALEWTFDHFFTPPLASNSPFKVVVVHAKTPATSVVASLAEPGIAEVLPQVKSDLKKIAARDIEKAKEICIIKSVSDVI FEVVEGDPRNVLCEAVEKHHASVLVVGSHGYGAIKRAVLGSVSDYCVHNARCTVMIVKRPKMP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G47710			Adenine nucleotide alpha hydro...		Potri.002G193800 [exp]	0	1
AT2G30620			winged-helix DNA-binding trans...		Potri.013G042700 [exp]	1.73	0.8381	HON902
AT1G79840	HD	GL2	GLABRA 2, HD-ZIP IV family of ...		Potri.003G052400 [exp]	5.74	0.8162	GL2.1
AT3G28050			nodulin MtN21 /EamA-like trans...		Potri.001G337100 [exp]	6.08	0.7729
AT5G49660		XIP1	XYLEM INTERMIXED WITH PHLOEM 1...		Potri.002G111700 [exp]	12.32	0.7944
AT2G17440		PIRL5	plant intracellular ras group-...		Potri.003G090100 [exp]	13.41	0.8130
AT5G41840			F-box/RNI-like superfamily pro...		Potri.006G244700 [exp]	16.24	0.7508
AT4G16580			Protein phosphatase 2C family ...		Potri.014G042800 [exp]	17.14	0.7794
AT4G17900			PLATZ transcription factor fam...		Potri.001G141500 [exp]	21.16	0.7848
AT5G58720			smr (Small MutS Related) domai...		Potri.009G046300 [exp]	23.45	0.7894
AT5G01950			Leucine-rich repeat protein ki...		Potri.016G140300 [exp]	26.26	0.8004

Compare expression of checked genes

Potri.002G193800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.