Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02550 87 / 1e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G47340 80 / 9e-18 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G23350 55 / 3e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G14300 54 / 2e-08 ATPMEPCRC, ATPME26 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) AT3G47670 53 / 3e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G51520 45 / 8e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G53840 45 / 2e-05 ATPME1 pectin methylesterase 1 (.1) AT5G53370 44 / 5e-05 ATPMEPCRF pectin methylesterase PCR fragment F (.1) AT5G04960 42 / 0.0003 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G49220 41 / 0.0006 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G194900 [exp] 371 / 7e-132 AT1G02550 87 / 2e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G119200 [exp] 220 / 3e-72 AT1G02550 97 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G119400 [exp] 156 / 7e-46 AT1G02550 78 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.002G195000 [exp] 142 / 1e-41 AT1G02550 76 / 3e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G162700 [exp] 59 / 7e-10 AT1G53840 659 / 0.0 pectin methylesterase 1 (.1) Potri.001G108200 [exp] 57 / 1e-09 AT3G47670 122 / 1e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G072700 [exp] 54 / 4e-08 AT1G53840 723 / 0.0 pectin methylesterase 1 (.1) Potri.003G123500 [exp] 49 / 5e-07 AT3G47670 141 / 8e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G129400 [exp] 49 / 7e-07 AT3G62820 163 / 6e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025021 [exp] 102 / 2e-25 AT3G14300 63 / 2e-10 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) Lus10002420 [exp] 101 / 2e-25 AT3G36659 54 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10010002 [exp] 102 / 1e-24 AT3G14300 / A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) Lus10001448 [exp] 59 / 5e-11 AT1G23350 48 / 7e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10018615 [exp] 56 / 2e-09 AT1G02550 49 / 3e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 51 / 1e-07 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10029877 [exp] 51 / 1e-07 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10038295 [exp] 51 / 2e-07 ND 37 / 0.005 Lus10008201 [exp] 50 / 3e-07 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001464 [exp] 49 / 3e-07 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.002G194800.1 pacid=42777738 polypeptide=Potri.002G194800.1.p locus=Potri.002G194800 ID=Potri.002G194800.1.v4.1 annot-version=v4.1 ATGGAGCTTAACAAGTTCATCCTTCTCCTTATTTCCTCTTCTCTCCTCCCATTTTTGGCCGGGGCCACTTTTGAGGCTCCAGGGATTGCTGATGCCCTAG GGCCGGCCATGTCTTCCTTATCTGCGGCAACCACCCGATCCCCATTGCCACCTCCAGTTGTCTCCCCCACCATTCGATCCCCATTTCCGTCGCCAGTTTC CTCCCCATCACCGCCTGATTCTCCAGCACATTCATCCTCCACACTGCCATTACTATCCAACAATGCTGCACTGACGAAAATATGTGACGTAACCCGTTAC CCAGCAGAATGTCTTGCCACCATTGCTCCTTTCCTAACTGGCGAAACCAATCCCATTTCAGTCCTTAAAATCGGGATACATGCTCTCCAAAAGAGTTTTG AAGAGGCCACGGCTGTTGCCACGAAAATAATCAACGATCTCTCTACAACAGCAGCGGTTAAGGCCCCCCTTGACACATGCGTTGAGTCTTTTGATAGCGG AATCGCTGTTCTCAATGACGCTTTGACTGCAATTTCCGCTCACGACATAGGCAGGCTGAGCACTAAGCTAAGTTCCGCTTTAACATATTCTGACACATGT GAGGAAGCATTTGCCGAGCAACCAGACCTCGAATCACCATTGCAAGAGACGGGTCAGCATCTGGATAAGTTGGCTAGCATCAACTTGGCCATTTCTGCAT CTCTCCAATGGAGTTAA
AA sequence Show only first row Show all	>Potri.002G194800.1 pacid=42777738 polypeptide=Potri.002G194800.1.p locus=Potri.002G194800 ID=Potri.002G194800.1.v4.1 annot-version=v4.1 MELNKFILLLISSSLLPFLAGATFEAPGIADALGPAMSSLSAATTRSPLPPPVVSPTIRSPFPSPVSSPSPPDSPAHSSSTLPLLSNNAALTKICDVTRY PAECLATIAPFLTGETNPISVLKIGIHALQKSFEEATAVATKIINDLSTTAAVKAPLDTCVESFDSGIAVLNDALTAISAHDIGRLSTKLSSALTYSDTC EEAFAEQPDLESPLQETGQHLDKLASINLAISASLQWS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G02550			Plant invertase/pectin methyle...		Potri.002G194800 [exp]	0	1
AT1G02550			Plant invertase/pectin methyle...		Potri.002G194900 [exp]	1.00	0.8262
					Potri.001G360550 [exp]	6.48	0.7774
AT5G53400		BOB1, BOBBER1	BOBBER1, HSP20-like chaperones...		Potri.003G100900 [exp]	33.04	0.7374
AT5G18930		BUD2, SAMDC4	BUSHY AND DWARF 2, Adenosylmet...		Potri.010G028500 [exp]	60.99	0.6973
AT2G39870			unknown protein		Potri.008G062200 [exp]	63.79	0.6756
AT5G65420		CYCD4;1	CYCLIN D4;1 (.1.2.3)		Potri.005G157800 [exp]	117.47	0.6766
AT1G22030			unknown protein		Potri.005G170700 [exp]	174.98	0.6485

Compare expression of checked genes

Potri.002G194800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.