Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02010 198 / 8e-61 Protein kinase superfamily protein (.1) AT2G20300 69 / 1e-14 ALE2 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) AT1G61860 61 / 1e-11 Protein kinase superfamily protein (.1) AT2G17220 59 / 5e-11 Kin3 kinase 3, Protein kinase superfamily protein (.1.2) AT1G53420 56 / 3e-10 Leucine-rich repeat transmembrane protein kinase (.1) AT1G54820 56 / 4e-10 Protein kinase superfamily protein (.1) AT3G58690 56 / 5e-10 Protein kinase superfamily protein (.1) AT1G78980 56 / 8e-10 SRF5 STRUBBELIG-receptor family 5 (.1) AT5G18610 54 / 3e-09 Protein kinase superfamily protein (.1.2) AT5G02290 52 / 7e-09 NAK Protein kinase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G194700 [exp] 248 / 1e-79 AT4G02010 958 / 0.0 Protein kinase superfamily protein (.1) Potri.014G119100 [exp] 236 / 3e-75 AT4G02010 993 / 0.0 Protein kinase superfamily protein (.1) Potri.002G254600 [exp] 74 / 4e-16 AT2G20300 947 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Potri.014G194300 [exp] 70 / 7e-15 AT2G20300 966 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Potri.011G000500 [exp] 63 / 2e-12 AT3G20530 481 / 2e-170 Protein kinase superfamily protein (.1) Potri.006G152000 [exp] 61 / 1e-11 AT5G56890 846 / 0.0 Protein kinase superfamily protein (.1) Potri.004G018500 [exp] 59 / 3e-11 AT3G20530 473 / 2e-167 Protein kinase superfamily protein (.1) Potri.013G025700 [exp] 56 / 4e-10 AT1G54820 438 / 7e-152 Protein kinase superfamily protein (.1) Potri.001G060800 [exp] 56 / 5e-10 AT5G13160 714 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011466 [exp] 188 / 2e-56 AT2G47330 1110 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10037526 [exp] 183 / 2e-55 AT4G02010 865 / 0.0 Protein kinase superfamily protein (.1) Lus10011917 [exp] 71 / 3e-15 AT2G20300 951 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Lus10022848 [exp] 67 / 6e-14 AT2G20300 912 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Lus10027635 [exp] 63 / 3e-12 AT5G56890 887 / 0.0 Protein kinase superfamily protein (.1) Lus10017647 [exp] 57 / 3e-10 AT3G58690 597 / 0.0 Protein kinase superfamily protein (.1) Lus10033606 [exp] 57 / 3e-10 AT3G58690 606 / 0.0 Protein kinase superfamily protein (.1) Lus10015756 [exp] 56 / 4e-10 AT5G13160 732 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1) Lus10004461 [exp] 56 / 5e-10 AT1G54820 465 / 4e-161 Protein kinase superfamily protein (.1) Lus10029948 [exp] 56 / 5e-10 AT1G54820 469 / 1e-162 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G194850.1 pacid=42776817 polypeptide=Potri.002G194850.1.p locus=Potri.002G194850 ID=Potri.002G194850.1.v4.1 annot-version=v4.1 ATGGCCAGGCCCATTCTGAGAGACAAGGACCAGTTAGAAGAGCTCGCTGATCCAAGGCTTGGAGGGAAATATCCCAAGGAAGATTTTGTACGAGTCTGCA CAATTGCAGCAGCTTGTGTTGCCTCTGAGGCAAGCCAGCGACCGACCATGGGTGAAGTAGTACAGCCACTTAAAATGGTGCACCGTGTAATGGAATATCA AGATTCCATGTCAACGTCCAATGCCCGGGCCAACCTGAGGCAGTCATCTAATACCTTCGAATCTGATGGGACATCTTCAATGTTCTCCTCTGGTCCATAC TCTAGCCTAAGTGCCTTAGATAACGACAATATCTCTCGGACAGCAGTTTTCTCTGAAGATCTTCATGAAGGACGATGA
AA sequence Show only first row Show all	>Potri.002G194850.1 pacid=42776817 polypeptide=Potri.002G194850.1.p locus=Potri.002G194850 ID=Potri.002G194850.1.v4.1 annot-version=v4.1 MARPILRDKDQLEELADPRLGGKYPKEDFVRVCTIAAACVASEASQRPTMGEVVQPLKMVHRVMEYQDSMSTSNARANLRQSSNTFESDGTSSMFSSGPY SSLSALDNDNISRTAVFSEDLHEGR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G02010			Protein kinase superfamily pro...		Potri.002G194850 [exp]	0	1
AT1G69230		SP1L2	SPIRAL1-like2 (.1.2)		Potri.017G095200 [exp]	1.73	0.9476
AT3G57830			Leucine-rich repeat protein ki...		Potri.016G050800 [exp]	2.44	0.9343
AT1G16170			unknown protein		Potri.001G039700 [exp]	4.58	0.9391
AT1G62981			Protein of unknown function (D...		Potri.001G112800 [exp]	6.00	0.9386
AT1G20530			Protein of unknown function (D...		Potri.005G249400 [exp]	9.16	0.9314
AT5G15900		TBL19	TRICHOME BIREFRINGENCE-LIKE 19...		Potri.017G110200 [exp]	10.00	0.9072
AT1G19780		ATCNGC8	cyclic nucleotide gated channe...		Potri.003G183000 [exp]	10.19	0.9131
AT1G32860			Glycosyl hydrolase superfamily...		Potri.001G449100 [exp]	10.48	0.9144
AT1G74690		IQD31	IQ-domain 31 (.1)		Potri.015G063600 [exp]	10.58	0.9198
AT4G23930			Late embryogenesis abundant (L...		Potri.001G090400 [exp]	11.83	0.8969

Compare expression of checked genes

Potri.002G194850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.