Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02550 87 / 1e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G47340 81 / 3e-18 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G36659 64 / 4e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G23350 56 / 8e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47670 57 / 2e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G14300 56 / 8e-09 ATPMEPCRC, ATPME26 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) AT1G53840 47 / 8e-06 ATPME1 pectin methylesterase 1 (.1) AT5G51520 45 / 1e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46940 43 / 6e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G49220 43 / 0.0001 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G194800 [exp] 371 / 8e-132 AT1G02550 87 / 2e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G119200 [exp] 222 / 7e-73 AT1G02550 97 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G119400 [exp] 159 / 8e-47 AT1G02550 78 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.002G195000 [exp] 142 / 2e-41 AT1G02550 76 / 3e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G108200 [exp] 59 / 2e-10 AT3G47670 122 / 1e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G162700 [exp] 57 / 2e-09 AT1G53840 659 / 0.0 pectin methylesterase 1 (.1) Potri.003G072700 [exp] 54 / 3e-08 AT1G53840 723 / 0.0 pectin methylesterase 1 (.1) Potri.003G123500 [exp] 53 / 4e-08 AT3G47670 141 / 8e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G129400 [exp] 49 / 3e-07 AT3G62820 163 / 6e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010002 [exp] 103 / 3e-25 AT3G14300 / A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) Lus10002420 [exp] 100 / 4e-25 AT3G36659 54 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10025021 [exp] 102 / 5e-25 AT3G14300 63 / 2e-10 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) Lus10001448 [exp] 58 / 7e-11 AT1G23350 48 / 7e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038295 [exp] 54 / 3e-08 ND 37 / 0.005 Lus10031711 [exp] 53 / 3e-08 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10018615 [exp] 52 / 4e-08 AT1G02550 49 / 3e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031132 [exp] 51 / 8e-08 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10029877 [exp] 51 / 1e-07 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10001464 [exp] 50 / 2e-07 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.002G194900.1 pacid=42778777 polypeptide=Potri.002G194900.1.p locus=Potri.002G194900 ID=Potri.002G194900.1.v4.1 annot-version=v4.1 ATGGAGCTTAACAAGTTCATCCTTCTCCTTATTTCCTCTTCTATCCTCCCATTTTTGGCCGGGGCCACTTTTGAGGCTCCAGGGATTGCTGATGCCCTAG GGCCGGCCATGTCTTCCTTATCTGCGGCAACCACCCGATCCCCATTGCCACCTCCAGTTGTCTCCCCCACCATGCGATCCCCATTTCCGTCGCCAGTTTC CTCCCCATCACCGCCTGATTCTCCAGCACATTCATCCTCCACACTGCCATTACTATCCAACAATGCTGCACTGACGAAAATATGTGACGTAACCCGTTAC CCAGCAGAATGTCTTGCCACCATTGCTCCTTTCCTAACTGGCGAAACCAATCCCATTTCAGTCCTTAAAATCGGGATACATGCTCTCCAAAAGAGTTTTG AAGAGGCCACGGCTGTTGCCACGAAAGTAATCAACGATCTCTCTACAACAGCAGCGGTTAAGGCCCCCCTTGACACATGCGTTGAGTCTTTTGATAGCGG AATCGCTGTTCTCAATGACGCTTTGACTGCAATTTCCGCTCACGACATAGGCAGGCTGAGCACTAAGCTAAGTGCCGCTTTAACATATTCTGACACATGT GAGGAAGCATTTGCCGAGCAACCAGACCTCGAATCACCATTGAAAGAGACGGCTCAGCATCTGGATAAGTTGGCTAGCATCAACTTGGCCATTTCTGCAT CTCTCCAATGGAGTTAA
AA sequence Show only first row Show all	>Potri.002G194900.1 pacid=42778777 polypeptide=Potri.002G194900.1.p locus=Potri.002G194900 ID=Potri.002G194900.1.v4.1 annot-version=v4.1 MELNKFILLLISSSILPFLAGATFEAPGIADALGPAMSSLSAATTRSPLPPPVVSPTMRSPFPSPVSSPSPPDSPAHSSSTLPLLSNNAALTKICDVTRY PAECLATIAPFLTGETNPISVLKIGIHALQKSFEEATAVATKVINDLSTTAAVKAPLDTCVESFDSGIAVLNDALTAISAHDIGRLSTKLSAALTYSDTC EEAFAEQPDLESPLKETAQHLDKLASINLAISASLQWS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G02550			Plant invertase/pectin methyle...		Potri.002G194900 [exp]	0	1
AT1G02550			Plant invertase/pectin methyle...		Potri.002G194800 [exp]	1.00	0.8262
					Potri.001G360550 [exp]	7.21	0.7902
AT2G24400			SAUR-like auxin-responsive pro...		Potri.006G278100 [exp]	49.11	0.7645
					Potri.002G048450 [exp]	71.55	0.7656
AT1G51510		Y14	RNA-binding (RRM/RBD/RNP motif...		Potri.006G048300 [exp]	95.02	0.7427
AT2G16920		UBC23 ,PFU2	PHO2 FAMILY UBIQUITIN CONJUGAT...		Potri.013G108500 [exp]	108.12	0.7442
AT3G21200		PGR7	proton gradient regulation 7 (...		Potri.008G008801 [exp]	130.53	0.7517
AT5G14070		ROXY2	Thioredoxin superfamily protei...		Potri.003G167000 [exp]	133.98	0.7382	PtrGrx22
AT2G38152			alpha 1,4-glycosyltransferase ...		Potri.006G098900 [exp]	147.06	0.7441
					Potri.003G024966 [exp]	167.15	0.7372

Compare expression of checked genes

Potri.002G194900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.