Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62410 90 / 6e-24 CP12-2 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) AT2G47400 76 / 1e-18 CP12-1 CP12 domain-containing protein 1 (.1) AT1G76560 52 / 3e-09 CP12-3 CP12 domain-containing protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G120700 [exp] 167 / 1e-54 AT3G62410 122 / 5e-37 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) Potri.002G002700 [exp] 56 / 1e-10 AT1G76560 109 / 1e-31 CP12 domain-containing protein 3 (.1) Potri.005G258400 [exp] 55 / 2e-10 AT1G76560 114 / 1e-33 CP12 domain-containing protein 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001453 [exp] 79 / 1e-19 AT2G47400 126 / 1e-38 CP12 domain-containing protein 1 (.1) Lus10002428 [exp] 77 / 4e-19 AT2G47400 125 / 4e-38 CP12 domain-containing protein 1 (.1) Lus10025025 [exp] 76 / 2e-18 AT2G47400 125 / 2e-38 CP12 domain-containing protein 1 (.1) Lus10010006 [exp] 38 / 0.0005 AT2G47400 59 / 4e-12 CP12 domain-containing protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02672 [poplar] [flax] CP12 CP12 domain
Representative CDS sequence Show only first row Show all	>Potri.002G196100.3 pacid=42780120 polypeptide=Potri.002G196100.3.p locus=Potri.002G196100 ID=Potri.002G196100.3.v4.1 annot-version=v4.1 ATGGCAACAATAGCTGGTCTTAACCTCTCAACACCTAGAGTCTTAGCTAAGGCAACAGACAAACCAAAAGCTCAAGCCCTCGTCAAGTTAAACCAGCCAT GGAGGAGGACATACCACCTGGGGTCCGGTGGGCGCATGCAAATCCGACCCGTGAGGGCTGCCCCTGATAGCATATCAGAGAAGGTTGAAAAGAGCATAAA AGATGCAGAGGCGGCCTGCTCCGATGATGCAGCAAGTGGAGAATGCGCAGCCGCATGGGATGAGGTGGAGGAGTTGAGTGCTGCTGCTAGCCATGCCAAG GACAAGAAGAAAGGGTCTGACCCTTTGGAGGAGTATTGCAAGGACAACCCTGAGACAGACGAGTGCCGCACTTATGAAGATTGA
AA sequence Show only first row Show all	>Potri.002G196100.3 pacid=42780120 polypeptide=Potri.002G196100.3.p locus=Potri.002G196100 ID=Potri.002G196100.3.v4.1 annot-version=v4.1 MATIAGLNLSTPRVLAKATDKPKAQALVKLNQPWRRTYHLGSGGRMQIRPVRAAPDSISEKVEKSIKDAEAACSDDAASGECAAAWDEVEELSAAASHAK DKKKGSDPLEEYCKDNPETDECRTYED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G62410		CP12-2	CP12 DOMAIN-CONTAINING PROTEIN...		Potri.002G196100 [exp]	0	1
AT1G63970		MECPS, ISPF	2C-METHYL-D-ERYTHRITOL 2,4-CYC...		Potri.001G099300 [exp]	2.64	0.9849
AT3G23400		FIB4	fibrillin 4, Plastid-lipid ass...		Potri.008G169100 [exp]	3.16	0.9838
AT4G03280		PGR1, PETC	PROTON GRADIENT REGULATION 1, ...		Potri.013G148900 [exp]	3.16	0.9805	Pt-PETC.2
AT5G36120		atylmg3, CCB3	"cofactor assembly, complex C ...		Potri.002G062100 [exp]	4.24	0.9819
AT5G17170		ENH1	enhancer of sos3-1, rubredoxin...		Potri.019G042600 [exp]	4.47	0.9817
AT4G00030			Plastid-lipid associated prote...		Potri.014G058400 [exp]	7.21	0.9657
AT1G79040		PSBR	photosystem II subunit R (.1)		Potri.001G438700 [exp]	7.54	0.9728
AT3G50685			unknown protein		Potri.007G027400 [exp]	10.39	0.9752
AT1G10500		ATCPISCA	chloroplast-localized ISCA-lik...		Potri.005G085400 [exp]	11.22	0.9725
AT5G13510		EMB3136	EMBRYO DEFECTIVE 3136, Ribosom...		Potri.010G215900 [exp]	11.48	0.9782

Compare expression of checked genes

Potri.002G196100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.