Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62420 182 / 2e-60 bZIP ATBZIP53 basic region/leucine zipper motif 53 (.1) AT1G75390 118 / 1e-34 bZIP ATBZIP44 basic leucine-zipper 44 (.1.2) AT2G18160 92 / 2e-24 bZIP GBF5, ATBZIP2 G-BOX BINDING FACTOR 5, basic leucine-zipper 2 (.1) AT4G34590 89 / 5e-23 bZIP ATB2, ATBZIP11, BZIP11, GBF6 Arabidopsis thaliana basic leucine-zipper 11, G-box binding factor 6 (.1) AT5G49450 70 / 5e-16 bZIP ATBZIP1 basic leucine-zipper 1 (.1) AT2G04038 64 / 1e-13 bZIP ATBZIP48 basic leucine-zipper 48 (.1) AT5G38800 63 / 6e-13 bZIP ATBZIP43 basic leucine-zipper 43 (.1) AT1G13600 63 / 7e-13 bZIP ATBZIP58 basic leucine-zipper 58 (.1) AT5G15830 62 / 1e-12 bZIP ATBZIP3 basic leucine-zipper 3 (.1) AT3G30530 60 / 6e-12 bZIP ATBZIP42 basic leucine-zipper 42 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G120800 [exp] 238 / 4e-82 AT3G62420 161 / 8e-52 basic region/leucine zipper motif 53 (.1) Potri.004G158200 [exp] 127 / 2e-38 AT1G75390 152 / 8e-48 basic leucine-zipper 44 (.1.2) Potri.009G119700 [exp] 122 / 2e-36 AT4G34590 154 / 9e-49 Arabidopsis thaliana basic leucine-zipper 11, G-box binding factor 6 (.1) Potri.002G031900 [exp] 121 / 9e-36 AT1G75390 128 / 3e-38 basic leucine-zipper 44 (.1.2) Potri.005G231300 [exp] 120 / 1e-35 AT1G75390 172 / 2e-55 basic leucine-zipper 44 (.1.2) Potri.008G106700 [exp] 103 / 3e-29 AT3G62420 88 / 6e-23 basic region/leucine zipper motif 53 (.1) Potri.010G142900 [exp] 102 / 1e-28 AT5G49450 85 / 7e-22 basic leucine-zipper 1 (.1) Potri.005G119300 [exp] 96 / 1e-25 AT2G18160 130 / 3e-39 G-BOX BINDING FACTOR 5, basic leucine-zipper 2 (.1) Potri.007G019900 [exp] 95 / 3e-25 AT1G75390 130 / 5e-39 basic leucine-zipper 44 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010005 [exp] 181 / 2e-59 AT3G62420 164 / 1e-52 basic region/leucine zipper motif 53 (.1) Lus10025024 [exp] 180 / 5e-59 AT3G62420 161 / 9e-52 basic region/leucine zipper motif 53 (.1) Lus10024279 [exp] 115 / 2e-33 AT1G75390 166 / 6e-53 basic leucine-zipper 44 (.1.2) Lus10001347 [exp] 108 / 2e-30 AT1G75390 159 / 4e-50 basic leucine-zipper 44 (.1.2) Lus10040428 [exp] 97 / 5e-26 AT1G75390 148 / 8e-46 basic leucine-zipper 44 (.1.2) Lus10041780 [exp] 96 / 2e-25 AT1G75390 135 / 2e-40 basic leucine-zipper 44 (.1.2) Lus10028333 [exp] 95 / 3e-25 AT1G75390 134 / 5e-40 basic leucine-zipper 44 (.1.2) Lus10016884 [exp] 71 / 3e-16 AT5G49450 80 / 8e-20 basic leucine-zipper 1 (.1) Lus10037750 [exp] 66 / 2e-14 AT5G49450 85 / 1e-21 basic leucine-zipper 1 (.1) Lus10013059 [exp] 65 / 2e-13 AT3G30530 147 / 8e-45 basic leucine-zipper 42 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0018 [poplar] [flax] bZIP PF00170 [poplar] [flax] bZIP_1 bZIP transcription factor
Representative CDS sequence Show only first row Show all	>Potri.002G196200.1 pacid=42776998 polypeptide=Potri.002G196200.1.p locus=Potri.002G196200 ID=Potri.002G196200.1.v4.1 annot-version=v4.1 ATGTCTGCAAGGCAAGCGGCGAGCTCAGGATCGGATAGTGATCCGCGATATGCGAATGTCGATGAGAGGAAAAGGAAGAGGATGATATCCAACAGGGAAT CTGCGAGGCGTTCCAGGATGAGGAAGCAGAAACAAATGGGGGATTTGGTCAATGAAGTGAGCAAATTGCAGAACGAGAACAATCAGTTGATGCAGGGTAT CAATGTTGGCCAACAACGCCGCATGGCGATGGAGTCAGCCAACAATGTCCTGAGGGCTCAGGCTGTGGAATTGACTGAGAGGCTGCGGTCGTTGAACTCT GTGTTGCAGATTGTGGAGGATGTTAGTGGGCTCTCTATGGAGATACCCGAAATACCCGATCCTTTGTTGAAGCCGTGGCAGCTCCCCTGTTCAGTAATGC CCATCATGGCATCTGCTGATATGTTTCAATATTAG
AA sequence Show only first row Show all	>Potri.002G196200.1 pacid=42776998 polypeptide=Potri.002G196200.1.p locus=Potri.002G196200 ID=Potri.002G196200.1.v4.1 annot-version=v4.1 MSARQAASSGSDSDPRYANVDERKRKRMISNRESARRSRMRKQKQMGDLVNEVSKLQNENNQLMQGINVGQQRRMAMESANNVLRAQAVELTERLRSLNS VLQIVEDVSGLSMEIPEIPDPLLKPWQLPCSVMPIMASADMFQY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G62420	bZIP	ATBZIP53	basic region/leucine zipper mo...		Potri.002G196200 [exp]	0	1
AT5G66900			Disease resistance protein (CC...		Potri.007G038900 [exp]	6.63	0.8303
AT3G24050	GATA	GATA1	GATA transcription factor 1 (....		Potri.001G053500 [exp]	7.07	0.8034
AT5G43470		HRT, RCY1, RPP8	RECOGNITION OF PERONOSPORA PAR...		Potri.003G149800 [exp]	11.13	0.8276
AT3G45640		ATMAPK3, ATMPK3	mitogen-activated protein kina...		Potri.009G066100 [exp]	17.91	0.8274	Pt-MPK3.2
AT3G47570			Leucine-rich repeat protein ki...		Potri.003G150000 [exp]	19.44	0.8045
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Potri.001G044500 [exp]	21.16	0.8244	Pt-WRKY40.1
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Potri.005G069500 [exp]	22.60	0.8151
AT5G66900			Disease resistance protein (CC...		Potri.007G039100 [exp]	23.02	0.8227
AT5G66850		MAPKKK5	mitogen-activated protein kina...		Potri.005G135100 [exp]	23.87	0.7821
AT5G66210		CPK28	calcium-dependent protein kina...		Potri.005G113600 [exp]	24.00	0.8115	CPK18

Compare expression of checked genes

Potri.002G196200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.