Potri.002G199100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02160 51 / 6e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G123500 140 / 3e-42 AT5G61710 42 / 6e-05 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025039 63 / 2e-12 AT5G61710 51 / 2e-08 unknown protein
Lus10010018 49 / 1e-07 AT4G02160 43 / 7e-06 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05553 DUF761 Cotton fibre expressed protein
Representative CDS sequence
>Potri.002G199100.1 pacid=42778884 polypeptide=Potri.002G199100.1.p locus=Potri.002G199100 ID=Potri.002G199100.1.v4.1 annot-version=v4.1
ATGGAACATAAATCAGACGCCGTCATTGATATTGTCAGTGCTGTCAACAACCATCAAGATGGCGTCCCAAAGACCAAGAAGAAAAAGCGACGCAGTGCAA
TGCACATCCTTAGGGTGGCCATGTACATGCTGTCTCTAAGATCTGGCAAATCAAAATCTGTCCAGACAGATGTTGCTTCAAAGTGGAAGAAGTACTTGTC
TTTCATGCGTCCTTTGCACGTTCACAGCAACCAACAACGCATCGAGGCCACACCGGCACCTGTAACATCCACGGCGGTTGATGAAGAATCAAAAGTTACA
CCTCCGGCGGCTTCCGTGGATGTTGTTGAGCAATATTTAGAGGTGCTTACCCCATCTTATTCACCGGCCCCAAAAAGCATCGCGTCATCCTCGTCGGGTC
AAACTAGCCAATACGCATCGGCGCAAAATCTTCTAGATCTTCTAATTGATATGAGTGATGAAGATGAGGATGGGGATGAGGATAGTTATTATGATGATAA
ATATGGGGACGAAACGATAGACATGAAGGCTGAGCAGTTCATTGCTAAATTTTATGACCAAATGAAGCTTCAACACAAGAGTTACTGA
AA sequence
>Potri.002G199100.1 pacid=42778884 polypeptide=Potri.002G199100.1.p locus=Potri.002G199100 ID=Potri.002G199100.1.v4.1 annot-version=v4.1
MEHKSDAVIDIVSAVNNHQDGVPKTKKKKRRSAMHILRVAMYMLSLRSGKSKSVQTDVASKWKKYLSFMRPLHVHSNQQRIEATPAPVTSTAVDEESKVT
PPAASVDVVEQYLEVLTPSYSPAPKSIASSSSGQTSQYASAQNLLDLLIDMSDEDEDGDEDSYYDDKYGDETIDMKAEQFIAKFYDQMKLQHKSY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G02160 unknown protein Potri.002G199100 0 1
AT5G49460 ACLB-2 ATP citrate lyase subunit B 2 ... Potri.010G145766 4.00 0.8844
AT3G56380 ARR17 response regulator 17 (.1) Potri.019G058900 4.79 0.7005
AT3G23130 C2H2ZnF FLO10, FON1, SU... SUPERMAN, FLORAL ORGAN NUMBER ... Potri.008G163900 7.93 0.5723 Pt-FLO10.2
AT1G47230 CYCA3;4 CYCLIN A3;4 (.1.2) Potri.008G008551 10.09 0.8214
AT5G65840 Thioredoxin superfamily protei... Potri.007G007201 10.24 0.8217
Potri.001G357150 11.40 0.6968
AT1G75220 AtERDL6 ERD6-like 6, Major facilitator... Potri.005G122550 15.16 0.7681
Potri.015G072732 15.58 0.7916
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Potri.011G130666 16.43 0.7400
AT3G10080 RmlC-like cupins superfamily p... Potri.008G020800 16.70 0.6829

Potri.002G199100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.