Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05700 152 / 6e-46 Drought-responsive family protein (.1) AT5G26990 143 / 2e-42 Drought-responsive family protein (.1) AT4G02200 139 / 4e-41 Drought-responsive family protein (.1.2.3) AT3G06760 139 / 7e-41 Drought-responsive family protein (.1.2) AT5G49230 130 / 8e-38 HRB1 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) AT1G02750 116 / 4e-32 Drought-responsive family protein (.1.2) AT1G56280 110 / 8e-30 ATDI19 drought-induced 19 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G125500 [exp] 320 / 3e-112 AT3G05700 148 / 2e-44 Drought-responsive family protein (.1) Potri.013G011200 [exp] 182 / 8e-58 AT3G05700 250 / 1e-84 Drought-responsive family protein (.1) Potri.005G020900 [exp] 179 / 9e-57 AT3G05700 224 / 3e-74 Drought-responsive family protein (.1) Potri.010G000800 [exp] 159 / 5e-49 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.008G213400 [exp] 153 / 2e-46 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.019G027300 [exp] 82 / 4e-20 AT5G49230 123 / 1e-36 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.011G057200 [exp] 83 / 4e-19 AT3G06760 110 / 2e-29 Drought-responsive family protein (.1.2) Potri.012G086500 [exp] 67 / 2e-13 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013420 [exp] 174 / 2e-54 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2) Lus10031467 [exp] 162 / 1e-49 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1) Lus10010305 [exp] 160 / 3e-49 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2) Lus10001462 [exp] 150 / 3e-45 AT3G05700 124 / 5e-35 Drought-responsive family protein (.1) Lus10037819 [exp] 139 / 6e-41 AT5G49230 198 / 3e-64 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Lus10015214 [exp] 114 / 3e-31 AT5G26990 194 / 5e-63 Drought-responsive family protein (.1) Lus10002441 [exp] 88 / 3e-22 AT5G26990 95 / 3e-25 Drought-responsive family protein (.1) Lus10017097 [exp] 86 / 2e-20 AT5G49230 131 / 2e-38 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Lus10015412 [exp] 77 / 1e-16 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1) Lus10037717 [exp] 75 / 2e-15 AT4G16100 321 / 2e-103 Protein of unknown function (DUF789) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0361 [poplar] [flax] C2H2-zf PF05605 [poplar] [flax] zf-Di19 Drought induced 19 protein (Di19), zinc-binding CL0361 [poplar] [flax] PF14571 [poplar] [flax] Di19_C Stress-induced protein Di19, C-terminal
Representative CDS sequence Show only first row Show all	>Potri.002G200500.1 pacid=42776816 polypeptide=Potri.002G200500.1.p locus=Potri.002G200500 ID=Potri.002G200500.1.v4.1 annot-version=v4.1 ATGGAAGATGACACGTGGAGCTTTGGTCTCTCTACTTCTTCTTCAAGGAGCTATCAATCAGTTCTCAAGTCTCTTTCTGATCTTTGCATTGATTTTGAAG AGATAGAAGAAGAAGATGATGATGATGATTTAAGGACGGAGTATCAGTGCCCTTATTGTACAGATGATTTTGATTTAGTTGAGCTGTGCTTCCATGTTGA TGTGGAGCATTATTTAGAAGCCAAGTCTGGGGTATGCCCTGTTTGTTTCACCAAGGTGGGGGTGGATATGGTTGATCACATAACAACAGAACATCGAACA ATTTACAAGAGTTTGCAAAAACTGAAACTTCAGAAAGGTGAGTCACATTCGAATTCTACTTTTCTGAAGAAGGAGTTAGAGGATGGATATTGGCAAGCGT TATTTAGTGGATCATCCTCAGTGGTTTCTTCCTCCAATTTAGCACCTGATCCATTGCTTTCATTCCTTTGCAATGTACCCCCTGCTGAGAAGAATGAGAG TGCACAGCCTAGTTTATCAAGTAAAGTGACCGTAGAAGAGAAAAACTCAGATGTGAAACTATTGGAAAGGAATGATCACCTATCACCTTTGTCAGATGAG GAACACATGGAGAAGGCAAGGAGAAGTGAGTTCGTACAGGGACTGTTATTGTCCACTATATTTGATGATGGACAATGA
AA sequence Show only first row Show all	>Potri.002G200500.1 pacid=42776816 polypeptide=Potri.002G200500.1.p locus=Potri.002G200500 ID=Potri.002G200500.1.v4.1 annot-version=v4.1 MEDDTWSFGLSTSSSRSYQSVLKSLSDLCIDFEEIEEEDDDDDLRTEYQCPYCTDDFDLVELCFHVDVEHYLEAKSGVCPVCFTKVGVDMVDHITTEHRT IYKSLQKLKLQKGESHSNSTFLKKELEDGYWQALFSGSSSVVSSSNLAPDPLLSFLCNVPPAEKNESAQPSLSSKVTVEEKNSDVKLLERNDHLSPLSDE EHMEKARRSEFVQGLLLSTIFDDGQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05700			Drought-responsive family prot...		Potri.002G200500 [exp]	0	1
AT4G34131		UGT73B3	UDP-glucosyl transferase 73B3 ...		Potri.001G303000 [exp]	15.09	0.8028
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Potri.002G182400 [exp]	17.88	0.7590
AT4G34131		UGT73B3	UDP-glucosyl transferase 73B3 ...		Potri.001G303600 [exp]	19.89	0.7967
AT4G27470		ATRMA3	RING membrane-anchor 3 (.1)		Potri.011G120800 [exp]	20.78	0.7938
AT5G62520		SRO5	similar to RCD one 5 (.1.2)		Potri.015G076500 [exp]	23.21	0.7637
AT4G22740			glycine-rich protein (.1.2)		Potri.001G117400 [exp]	30.57	0.7761
AT3G53970			proteasome inhibitor-related (...		Potri.016G103800 [exp]	34.77	0.6646
AT1G55170			unknown protein		Potri.003G037900 [exp]	35.49	0.7114
AT3G13540	MYB	ATMYB5, ATM2	myb domain protein 5 (.1)		Potri.019G036340 [exp]	36.66	0.7426
AT5G62520		SRO5	similar to RCD one 5 (.1.2)		Potri.012G081100 [exp]	44.74	0.7259

Compare expression of checked genes

Potri.002G200500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.