Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47540 160 / 1e-50 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G02270 127 / 2e-37 RHS13 root hair specific 13 (.1) AT2G47530 87 / 1e-21 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G62680 87 / 1e-20 ATPRP3, PRP3 ARABIDOPSIS THALIANA PROLINE-RICH PROTEIN 3, proline-rich protein 3 (.1) AT1G54970 78 / 3e-17 RHS7, ATPRP1 ROOT HAIR SPECIFIC 7, proline-rich protein 1 (.1) AT2G34700 50 / 6e-08 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 42 / 7e-05 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G201800 [exp] 145 / 3e-44 AT4G02270 118 / 1e-33 root hair specific 13 (.1) Potri.017G145800 [exp] 137 / 2e-40 AT4G02270 118 / 5e-33 root hair specific 13 (.1) Potri.014G126500 [exp] 137 / 2e-39 AT2G47540 113 / 6e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126200 [exp] 137 / 3e-39 AT2G47540 114 / 3e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126250 [exp] 135 / 2e-38 AT2G47540 112 / 2e-29 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126300 [exp] 134 / 5e-38 AT2G47540 114 / 1e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G053600 [exp] 56 / 2e-09 AT2G34700 139 / 5e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G044700 [exp] 50 / 1e-07 AT2G34700 142 / 8e-43 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.006G119100 [exp] 44 / 2e-05 AT3G09925 180 / 7e-58 Pollen Ole e 1 allergen and extensin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008213 [exp] 128 / 1e-36 AT2G47540 127 / 2e-36 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013419 [exp] 116 / 3e-32 AT4G02270 118 / 3e-33 root hair specific 13 (.1) Lus10005539 [exp] 101 / 2e-26 AT4G02270 103 / 1e-27 root hair specific 13 (.1) Lus10041926 [exp] 99 / 2e-25 AT4G02270 100 / 5e-26 root hair specific 13 (.1) Lus10009837 [exp] 51 / 5e-08 AT5G05500 171 / 1e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014013 [exp] 51 / 7e-08 AT2G34700 137 / 2e-40 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10040948 [exp] 49 / 3e-07 AT5G05500 176 / 9e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10015434 [exp] 46 / 5e-06 AT1G28290 135 / 1e-39 arabinogalactan protein 31 (.1.2) Lus10010306 [exp] 41 / 0.0001 ND 38 / 9e-04
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [poplar] [flax] Transthyretin PF01190 [poplar] [flax] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Potri.002G201900.3 pacid=42777060 polypeptide=Potri.002G201900.3.p locus=Potri.002G201900 ID=Potri.002G201900.3.v4.1 annot-version=v4.1 ATGGCTCCTACCTCTTCCTACTTCGCCTTCTTCATGTCCCTGTCAATGGTGGCTGCTATTGCTTCGGCTACTGATGGGGGGTATGGTTCACATCCCAACC CTAACCTTGTAAAACCGAAGCTAAACAAGGAGAAGCCTCTCTCAACAATGATCGGTGTTCAAGGCCTTGTTTATTGCAGATCAGGCCCTAAACGCTTTCC ACTTGAAGGAGCTGTGATAAGGATAACATGCCTGGCTAACGATGTGTATGGATACGAAGCAGCGCCATTCTCATTTTTGAGTGAAGCAACCGATGCTAAA GGCTACTTTTTCGCCACGCTGTCCCCATATGAAATGCAGGATAATTTGAAGATTAAAGAGTGCAAGGCTTTTCTTGAGCTATCACCATTGGAGACCTGCA AAATTCCTACCGATGAGAAGCAAGGTATTTCTGGGGCTCTTCTTGCTTCTTACCACTACCTTAGTGATAAGAAAATGAAGTTGTTCACCGTGGGGCCTTT CGTTTACACCTCCGCACCCAACTCAGGCTCTAATTATTAA
AA sequence Show only first row Show all	>Potri.002G201900.3 pacid=42777060 polypeptide=Potri.002G201900.3.p locus=Potri.002G201900 ID=Potri.002G201900.3.v4.1 annot-version=v4.1 MAPTSSYFAFFMSLSMVAAIASATDGGYGSHPNPNLVKPKLNKEKPLSTMIGVQGLVYCRSGPKRFPLEGAVIRITCLANDVYGYEAAPFSFLSEATDAK GYFFATLSPYEMQDNLKIKECKAFLELSPLETCKIPTDEKQGISGALLASYHYLSDKKMKLFTVGPFVYTSAPNSGSNY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G47540			Pollen Ole e 1 allergen and ex...		Potri.002G201900 [exp]	0	1
AT4G23400		PIP1D, PIP1;5	plasma membrane intrinsic prot...		Potri.009G128000 [exp]	4.58	0.8330
AT2G04100			MATE efflux family protein (.1...		Potri.004G094800 [exp]	9.48	0.8554
AT1G71140			MATE efflux family protein (.1...		Potri.004G094900 [exp]	13.63	0.8546
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.006G170100 [exp]	16.00	0.8531
AT3G61430		ATPIP1, PIP1;1,...	PLASMA MEMBRANE INTRINSIC PROT...		Potri.004G167000 [exp]	16.88	0.8466
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.011G110400 [exp]	18.81	0.7742
AT2G31083		AtCLE5, CLE5, C...	CLAVATA3/ESR-RELATED 5 (.1)		Potri.019G090800 [exp]	19.28	0.8440	CLE4.1
AT5G02500		AtHsp70-1, AT-H...	HEAT SHOCK PROTEIN 70-1, ARABI...		Potri.008G054801 [exp]	21.16	0.7754
AT5G05500		MOP10	Pollen Ole e 1 allergen and ex...		Potri.008G072000 [exp]	22.97	0.8316
					Potri.006G017750 [exp]	23.87	0.8279

Compare expression of checked genes

Potri.002G201900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.